LXL04_032673 | RubberDandelionOmics

Gene overview

LXL04_032673

Reference: OH-1004 Chr: Chr07 Coordinates: 27561021-27565453 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3630 bp · LXL04_032673|LXL04_032673|OH1004|cDNA

ATGGAAACAGACACAACAATCACAAAACCGCAATCGAACATGACCCAAAGACTACTTCCAGCTGTTTTACCAGTTCTTTTTATAGCAATTACATATATAGATCCAGGAAAATGGGTAGCATCCATTGAAGGTGGAGCCCGTTTTGGCTATGATCTTGTGATACTTATGTTTATTTTTAGTTTGGCTGCTGTTTTATGTCATTACCTCTCGGCTTCTATTGCGATTGTCACTGGAAAAGATCTTGCTCAGATTTGCAGTGT...

CDS

Download CDS FASTA

3630 bp · LXL04_032673|LXL04_032673|OH1004|CDS

ATGGAAACAGACACAACAATCACAAAACCGCAATCGAACATGACCCAAAGACTACTTCCAGCTGTTTTACCAGTTCTTTTTATAGCAATTACATATATAGATCCAGGAAAATGGGTAGCATCCATTGAAGGTGGAGCCCGTTTTGGCTATGATCTTGTGATACTTATGTTTATTTTTAGTTTGGCTGCTGTTTTATGTCATTACCTCTCGGCTTCTATTGCGATTGTCACTGGAAAAGATCTTGCTCAGATTTGCAGTGT...

Protein

Download Protein FASTA

1209 aa · LXL04_032673|LXL04_032673|OH1004|PROTEIN

METDTTITKPQSNMTQRLLPAVLPVLFIAITYIDPGKWVASIEGGARFGYDLVILMFIFSLAAVLCHYLSASIAIVTGKDLAQICSVEYDAITCVLLGVQAELSMIALDLSMILGTAHALNLTFGIGLFTCVLLTSIDAFLFPVFSSYMETGKAKFICIRLATAALLCYLFGVVMSQHDTSLSMGGIVPRLNGESVFALMSLLGASIMPHNFYLHSSIVQQNQGPTQVSKEDLCNDHLFAIACGFSGIFVINYVLMNSAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032673`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032673

Location Chr07:27561021-27565453 (-)

Description Similar to EIN2: Ethylene-insensitive protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03280`	Central factor in signaling pathways regulated by ethylene (ET) and involved in various processes including development, plant defense, senescence, nucleotide sugar flux, and tropisms.	EIN2, a bifunctional transducer of ethylene and stress responses in Arabidopsis.1999 · DOI: 10.1126/science.284.5423.2148 Analysis of combinatorial loss-of-function mutants in the Arabidopsis ethylene receptors reveals that the ers1 etr1 double mutant has severe developmental defects that are EIN2 dependent.2003 · DOI: 10.1105/tpc.013060 Growth regulators and the control of nucleotide sugar flux.2004 · DOI: 10.1105/tpc.019661 Transcriptome analysis of O3-exposed Arabidopsis reveals that multiple signal pathways act mutually antagonistically to induce gene expression.2003 · DOI: 10.1023/b:plan.0000019064.55734.52 Transcriptional profiling by cDNA-AFLP and microarray analysis reveals novel insights into the early response to ethylene in Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02156.x Interplay between ethylene, ETP1/ETP2 F-box proteins, and degradation of EIN2 triggers ethylene responses in Arabidopsis.2009 · DOI: 10.1101/gad.1765709 Ethylene-induced stabilization of ETHYLENE INSENSITIVE3 and EIN3-LIKE1 is mediated by proteasomal degradation of EIN3 binding F-box 1 and 2 that requires EIN2 in Arabidopsis.2010 · DOI: 10.1105/tpc.110.076588 EIN2 regulates salt stress response and interacts with a MA3 domain-containing protein ECIP1 in Arabidopsis.2011 · DOI: 10.1111/j.1365-3040.2011.02363.x EIN2-directed translational regulation of ethylene signaling in Arabidopsis.2015 · DOI: 10.1016/j.cell.2015.09.037 Mitogen-activated protein kinase 6 mediates nuclear translocation of ORE3 to promote ORE9 gene expression in methyl jasmonate-induced leaf senescence.2016 · DOI: 10.1093/jxb/erv438 Cytokinin action is coupled to ethylene in its effects on the inhibition of root and hypocotyl elongation in Arabidopsis thaliana seedlings.1995 · DOI: 10.1104/pp.107.4.1075 Identification of three genetic loci controlling leaf senescence in Arabidopsis thaliana.1997 · DOI: 10.1046/j.1365-313x.1997.00527.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0155600`	Central factor in ethylene signaling pathways that control development, senescence and grain size.	OsEIN2 is a positive component in ethylene signaling in rice.2004 · DOI: 10.1093/pcp/pch033 Identification of rice ethylene-response mutants and characterization of MHZ7/OsEIN2 in distinct ethylene response and yield trait regulation.2013 · DOI: 10.1093/mp/sst087

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032673 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006828 manganese ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009725 response to hormone Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT5G03280

ddi:DDB_G0275815

dosa:Os07g0155600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.323

Rank 1 · LXL04_032673 · OH-1004

Endoplasmic reticulum0.256

Rank 2 · LXL04_032673 · OH-1004

Golgi apparatus0.149

Rank 3 · LXL04_032673 · OH-1004

Lysosome / Vacuole0.132

Rank 4 · LXL04_032673 · OH-1004

Cytoplasm0.129

Rank 5 · LXL04_032673 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01566.26Nramp26-414 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032673	`PF01566.26`	Nramp	26	414	1.2e-93	314.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S814`	Arabidopsis thaliana	Ethylene-insensitive protein 2	46.437%	Swiss-Prot	moderate database homology
`Q0D8I9`	Oryza sativa subsp. japonica	Protein ETHYLENE-INSENSITIVE 2	38.103%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card