RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_032378
Reference: OH-1004 Chr: Chr07 Coordinates: 21534037-21537285 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3142 bp · LXL04_032378|LXL04_032378|OH1004|cDNA

TTAAAAAATCTAACCAACTTCTCCAACAAAATCTTGTGTCCTTATTCAACAGTCTTATACACAAAACATAGATTCTTTACATCAGTAAACAAAAATGCGTTTCCCGTATACTATATATGTAGTTCTTTGTAATATTGTCTTAATTTTTTCTGTCGATGCTGGATATGACACCGATCGGTTGGCCTTGCTCTCACTCAAGGCCCATATAACATCCGACCCATATAAAATCATGCCTTCATGGAATGACTCGATCCACATCT...

CDS

Download CDS FASTA

3048 bp · LXL04_032378|LXL04_032378|OH1004|CDS

ATGCGTTTCCCGTATACTATATATGTAGTTCTTTGTAATATTGTCTTAATTTTTTCTGTCGATGCTGGATATGACACCGATCGGTTGGCCTTGCTCTCACTCAAGGCCCATATAACATCCGACCCATATAAAATCATGCCTTCATGGAATGACTCGATCCACATCTGCAACTGGACAGGCATCATATGTGGTCAGAGGCACCAGCGAGTGGTCACAATCAATTTGTGGTCAGGTGGGTTTTCAGGTCCCATATCTCCTGA...

Protein

Download Protein FASTA

1015 aa · LXL04_032378|LXL04_032378|OH1004|PROTEIN

MRFPYTIYVVLCNIVLIFSVDAGYDTDRLALLSLKAHITSDPYKIMPSWNDSIHICNWTGIICGQRHQRVVTINLWSGGFSGPISPEVGNMTFLRELLLHNNSFTGEVPQEIGRLSRLRRLGLSNNSLSGEIPMNISQCRNLIELDLSGNSFIGVIPKEFESLTKLLYINLHSNDITGEIPKFIGNFTSLMFISGLGNNFHGSIPDTLGRLSNLWFFGFAMNNLSGVLPPSFFNISSLTNIDLPDNQIGGNLPSDIAQKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_032378
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_032378
LocationChr07:21534037-21537285 (-)
DescriptionSimilar to At3g47570: Probable LRR receptor-like serine/threonine-protein kinase At3g47570
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g47570 Probable LRR receptor-like serine/threonine-protein kinase At3g47570. No verified direct reference in this release
At5g20480 Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs); phosphorylates BIK1 upon elicitation to regulate immune responses such as defense hormone expression (e.g. jasmonic acid (JA) and salicylic acid (SA)). No verified direct reference in this release
At3g47110 Putative receptor-like protein kinase At3g47110. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: Q1MX30 Receptor kinase that detects X.oryzae pv. oryzae protein Ax21 to promote innate immunity. No verified direct reference in this release
Os11g0569733 Receptor kinase that detects X.oryzae pv. oryzae protein Ax21 to promote innate immunity.
Cleavage and nuclear localization of the rice XA21 immune receptor.2012 · DOI: 10.1038/ncomms1932
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032378 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0002237 response to molecule of bacterial origin Biological Process
GO:0002764 immune response-regulating signaling pathway Biological Process
GO:0006952 defense response Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0016045 detection of bacterium Biological Process
GO:0031349 positive regulation of defense response Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process
GO:1900426 positive regulation of defense response to bacterium Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT3G47110
ath:AT3G47570
ath:AT5G20480
osa:107276510
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.874
Rank 1 · LXL04_032378 · OH-1004
Endoplasmic reticulum0.082
Rank 2 · LXL04_032378 · OH-1004
Cytoplasm0.058
Rank 3 · LXL04_032378 · OH-1004
Nucleus0.035
Rank 4 · LXL04_032378 · OH-1004
Lysosome / Vacuole0.025
Rank 5 · LXL04_032378 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_225-63 aa
PF23598.2LRR_1486-214 aa
PF13855.13LRR_8138-176 aa
PF23598.2LRR_14357-467 aa
PF13855.13LRR_8389-446 aa
PF13855.13LRR_8435-495 aa
PF23598.2LRR_14453-589 aa
PF13855.13LRR_8549-590 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_032378PF08263.18LRRNT_225634.6e-1040.3
LXL04_032378PF23598.2LRR_14862148.1e-33114.3
LXL04_032378PF13855.13LRR_81381761.8e-34118.0
LXL04_032378PF23598.2LRR_143574678.1e-33114.3
LXL04_032378PF13855.13LRR_83894461.8e-34118.0
LXL04_032378PF13855.13LRR_84354951.8e-34118.0
LXL04_032378PF23598.2LRR_144535898.1e-33114.3
LXL04_032378PF13855.13LRR_85495901.8e-34118.0
LXL04_032378PF00069.32Pkinase6999961.8e-36126.6
LXL04_032378PF07714.24PK_Tyr_Ser-Thr7009993.6e-38132.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
C0LGP4Arabidopsis thalianaProbable LRR receptor-like serine/threonine-protein kinase At3g4757043.143%Swiss-Protmoderate database homology
C0LGT6Arabidopsis thalianaLRR receptor-like serine/threonine-protein kinase EFR42.415%Swiss-Protmoderate database homology
Q9SD62Arabidopsis thalianaPutative receptor-like protein kinase At3g4711044.600%Swiss-Protmoderate database homology
Q1MX30Oryza sativa subsp. indicaReceptor kinase-like protein Xa2144.422%Swiss-Protmoderate database homology
Q2R2D5Oryza sativa subsp. japonicaReceptor kinase-like protein Xa2143.800%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser