LXL04_032325 | RubberDandelionOmics

Gene overview

LXL04_032325

Reference: OH-1004 Chr: Chr07 Coordinates: 20575880-20579610 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · LXL04_032325|LXL04_032325|OH1004|cDNA

ATGGTTGGAGATAACGAAAACATAATAGAATTGCATAGTGAGTTGAGGATGACTAACGGCGTGATGGGGCAGGTCCATGTGGACTATATTACCACCATGAATATTGTAaagaaacaaacaaaacataagGAGCGTAAACTGGAAAACATGAAAACTAAAAGGGGCCAAACAGAAAAATACAAGAGCTTTAAAAGAGAACGTGAGAGATTGAGAGAGAGAAAGGAGAACGGGCCAAGGCGTGCTTCTCTGTACTGTTATCG...

CDS

Download CDS FASTA

1086 bp · LXL04_032325|LXL04_032325|OH1004|CDS

ATGGTTGGAGATAACGAAAACATAATAGAATTGCATAGTGAGTTGAGGATGACTAACGGCGTGATGGGGCAGGTCCATGTGGACTATATTACCACCATGAATATTGTAAAGAAACAAACAAAACATAAGGAGCGTAAACTGGAAAACATGAAAACTAAAAGGGGCCAAACAGAAAAATACAAGAGCTTTAAAAGAGAACGTGAGAGATTGAGAGAGAGAAAGGAGAACGGGCCAAGGCGTGCTTCTCTGTACTGTTATCG...

Protein

Download Protein FASTA

361 aa · LXL04_032325|LXL04_032325|OH1004|PROTEIN

MVGDNENIIELHSELRMTNGVMGQVHVDYITTMNIVKKQTKHKERKLENMKTKRGQTEKYKSFKRERERLRERKENGPRRASLYCYRILWLVVRPAKQLQLFQVMASSMMILDPVTNNMDRARDSSKRRKKKKNQRHSSDGGSDQTNRNSNNNNNQIMTWKSEAQQQVYSSKLLQALRNVRVSSGTSPPSAPCRGRAVREAADRVLAVTAKGRSRWSRAILTNKIKLKFMKNNRRQRGTAVTATRNSRLKKPRVSILKLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032325`
TK1151 ID	TkA08G166370
OH-1004 ID	LXL04_032325
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 71.191 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032325

Location Chr07:20575880-20579610 (-)

Description Similar to BHLH147: Transcription factor bHLH147

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17100`	Atypical bHLH transcription factor probably unable to bind DNA.	No verified direct reference in this release
`At3g06590`	bHLH transcription factor that binds DNA on specific sequence 5'-CANNTG-3' in target gene promoters.	No verified direct reference in this release
`At1g09250`	Atypical bHLH transcription factor probably unable to bind DNA.	No verified direct reference in this release
`At3g05800`	Atypical bHLH transcription factor probably unable to bind DNA.	Regulation of Arabidopsis brassinosteroid signaling by atypical basic helix-loop-helix proteins.2009 · DOI: 10.1105/tpc.109.072504
`At2g43060`	Atypical and probable non DNA-binding bHLH transcription factor that acts as a transcriptional repressor that negatively regulates cell and organ elongation in response to gibberellin (GA) and brassinosteroid (BR) signaling.	Antagonistic HLH/bHLH transcription factors mediate brassinosteroid regulation of cell elongation and plant development in rice and Arabidopsis.2009 · DOI: 10.1105/tpc.109.070441 A triantagonistic basic helix-loop-helix system regulates cell elongation in Arabidopsis.2012 · DOI: 10.1105/tpc.112.105023 A triple helix-loop-helix/basic helix-loop-helix cascade controls cell elongation downstream of multiple hormonal and environmental signaling pathways in Arabidopsis.2012 · DOI: 10.1105/tpc.112.105163 Helix-loop-helix/basic helix-loop-helix transcription factor network represses cell elongation in Arabidopsis through an apparent incoherent feed-forward loop.2014 · DOI: 10.1073/pnas.1400203111

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032325 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G09250

ath:AT2G43060

ath:AT3G05800

ath:AT3G06590

ath:AT3G17100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · LXL04_032325 · OH-1004

Cytoplasm0.076

Rank 2 · LXL04_032325 · OH-1004

Cell membrane0.040

Rank 3 · LXL04_032325 · OH-1004

Endoplasmic reticulum0.028

Rank 4 · LXL04_032325 · OH-1004

Plastid0.019

Rank 5 · LXL04_032325 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26576.1IBH1_N164-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032325	`PF26576.1`	IBH1_N	164	223	3.6e-10	40.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSN7`	Arabidopsis thaliana	Transcription factor bHLH147	57.595%	Swiss-Prot	weak database homology
`Q9C8Z9`	Arabidopsis thaliana	Transcription factor bHLH148	57.059%	Swiss-Prot	weak database homology
`O80482`	Arabidopsis thaliana	Transcription factor bHLH149	43.750%	Swiss-Prot	weak database homology
`Q9M9L6`	Arabidopsis thaliana	Transcription factor bHLH150	43.590%	Swiss-Prot	weak database homology
`Q9SKX1`	Arabidopsis thaliana	Transcription factor IBH1	31.373%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card