LXL04_032267 | RubberDandelionOmics

Gene overview

LXL04_032267

Reference: OH-1004 Chr: Chr07 Coordinates: 19570771-19571316 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

466 bp · LXL04_032267|LXL04_032267|OH1004|cDNA

ATGATCTCCATGGCCATGGGTTCATTGTTCAAAGTAAACGAGTCCACCAAGACACCATCCATGGAGTACTCAAAAGCTGTTGGATTGAAGATTCTCACCACTAAAACCCCCCACCTTCATCATTCCAGACCCATTTTTCAAAGGAATcaaattccttcttcttcttcttcttcttcttcttcttccggtTCCATATGTTTCATCAAATCTTGCCTTCTATGCCACAAACATATTTCTCTTAACAAAGAGGTTTACATGTA...

CDS

Download CDS FASTA

444 bp · LXL04_032267|LXL04_032267|OH1004|CDS

ATGATCTCCATGGCCATGGGTTCATTGTTCAAAGTAAACGAGTCCACCAAGACACCATCCATGGAGTACTCAAAAGCTGTTGGATTGAAGATTCTCACCACTAAAACCCCCCACCTTCATCATTCCAGACCCATTTTTCAAAGGAATCAAATTCCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCCGGTTCCATATGTTTCATCAAATCTTGCCTTCTATGCCACAAACATATTTCTCTTAACAAAGAGGTTTACATGTA...

Protein

Download Protein FASTA

147 aa · LXL04_032267|LXL04_032267|OH1004|PROTEIN

MISMAMGSLFKVNESTKTPSMEYSKAVGLKILTTKTPHLHHSRPIFQRNQIPSSSSSSSSSSGSICFIKSCLLCHKHISLNKEVYMYRGDQSFCSEECRSRQIYIDDVKQLEITTKKMIQQYRQSSKKTRTHFSKESKSMASPVFCL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032267`
TK1151 ID	TkA08G162270
OH-1004 ID	LXL04_032267
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 87.898 / OH-1004 91.837 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032267

Location Chr07:19570771-19571316 (+)

Description Similar to FLZ18: FCS-Like Zinc finger 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53903`	May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.	No verified direct reference in this release
`At1g53885`	May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.	No verified direct reference in this release
`At2g44670`	May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.	No verified direct reference in this release
`At4g17670`	May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.	No verified direct reference in this release
`At5g47060`	May act as an adapter to facilitate the interaction of SnRK1 complex with effector proteins, conferring tissue- and stimulus-type specific differences in the SnRK1 regulation pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032267 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009646 response to absence of light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0034097 response to cytokine Biological Process

GO:0042594 response to starvation Biological Process

GO:0071368 cellular response to cytokinin stimulus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1902074 response to salt Biological Process

GO:1905582 response to mannose Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G53885

ath:AT1G53903

ath:AT2G44670

ath:AT4G17670

ath:AT5G47060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.723

Rank 1 · LXL04_032267 · OH-1004

Cytoplasm0.333

Rank 2 · LXL04_032267 · OH-1004

Cell membrane0.049

Rank 3 · LXL04_032267 · OH-1004

Endoplasmic reticulum0.030

Rank 4 · LXL04_032267 · OH-1004

Mitochondrion0.019

Rank 5 · LXL04_032267 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04570.21zf-FLZ59-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032267	`PF04570.21`	zf-FLZ	59	107	6.4e-19	67.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DO12`	Arabidopsis thaliana	FCS-Like Zinc finger 18	42.574%	Swiss-Prot	moderate database homology
`P0DO11`	Arabidopsis thaliana	FCS-Like Zinc finger 17	42.574%	Swiss-Prot	moderate database homology
`O80506`	Arabidopsis thaliana	FCS-Like Zinc finger 3	39.474%	Swiss-Prot	moderate database homology
`Q8VZM9`	Arabidopsis thaliana	FCS-Like Zinc finger 2	40.000%	Swiss-Prot	weak database homology
`Q9FGQ9`	Arabidopsis thaliana	FCS-Like Zinc finger 1	54.545%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card