LXL04_032251 | RubberDandelionOmics

Gene overview

LXL04_032251

Reference: OH-1004 Chr: Chr07 Coordinates: 19246985-19249177 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1395 bp · LXL04_032251|LXL04_032251|OH1004|cDNA

ATGGAATCAACACTAGAGACGATTGATTTCGAATCCGACGAAGAGAGCCCGTTAACTTTATCACAACCCATAGGCGCAAAGCAATCTTTTCAATTCGAGACATCATCTCATACAACTGTCCCCAAATTTCGTACCCTTAGAAGGCTTCAATTCACAGCTTTCCACAGCGTGTACGTTGTTTTAGTCAAAGCAAAGATCAATGTCTTGCTTCCTTTTGGACCTCTAGCAGTATTGATGCACTACACAACAGGCCGACATGT...

CDS

Download CDS FASTA

1395 bp · LXL04_032251|LXL04_032251|OH1004|CDS

ATGGAATCAACACTAGAGACGATTGATTTCGAATCCGACGAAGAGAGCCCGTTAACTTTATCACAACCCATAGGCGCAAAGCAATCTTTTCAATTCGAGACATCATCTCATACAACTGTCCCCAAATTTCGTACCCTTAGAAGGCTTCAATTCACAGCTTTCCACAGCGTGTACGTTGTTTTAGTCAAAGCAAAGATCAATGTCTTGCTTCCTTTTGGACCTCTAGCAGTATTGATGCACTACACAACAGGCCGACATGT...

Protein

Download Protein FASTA

464 aa · LXL04_032251|LXL04_032251|OH1004|PROTEIN

MESTLETIDFESDEESPLTLSQPIGAKQSFQFETSSHTTVPKFRTLRRLQFTAFHSVYVVLVKAKINVLLPFGPLAVLMHYTTGRHVSIFFHPLFIFSMTTKLKKSIFPFQGWVFFFSLLGITPLAERLGYATEQLACYTGNTVGGLLNATFGNATEMIISIYALKNGMIRVVQQSLLGSILSNMLLVLGCAFFTGGIVHYPKVQRFNQTAAIVSSGLLLMAVMGILFPAVLHFTHTEVHFGKSELALSRFSSCIMLVAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032251`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032251

Location Chr07:19246985-19249177 (+)

Description Similar to CAX2: Vacuolar cation/proton exchanger 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13320`	Vacuolar cation/proton exchanger (CAX).	Manganese specificity determinants in the Arabidopsis metal/H+ antiporter CAX2.2003 · DOI: 10.1074/jbc.m209952200
`At1g55730`	Vacuolar cation/proton exchanger (CAX).	No verified direct reference in this release
`At1g55720`	Vacuolar cation/proton exchanger (CAX).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0397400`	Vacuolar cation/proton exchanger (CAX).	Expression profile of the genes for rice cation/H+ exchanger family and functional analysis in yeast.2005 · DOI: 10.1093/pcp/pci173
`Os04g0653200`	Vacuolar cation/proton exchanger (CAX).	Expression profile of the genes for rice cation/H+ exchanger family and functional analysis in yeast.2005 · DOI: 10.1093/pcp/pci173

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032251 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0030001 metal ion transport Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0005773 vacuole Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0015369 calcium:proton antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G55720

ath:AT1G55730

ath:AT3G13320

dosa:Os03g0397400

dosa:Os04g0653200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.449

Rank 1 · LXL04_032251 · OH-1004

Cell membrane0.246

Rank 2 · LXL04_032251 · OH-1004

Cytoplasm0.191

Rank 3 · LXL04_032251 · OH-1004

Golgi apparatus0.138

Rank 4 · LXL04_032251 · OH-1004

Endoplasmic reticulum0.132

Rank 5 · LXL04_032251 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699.30Na_Ca_ex113-268 aa

PF01699.30Na_Ca_ex302-444 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032251	`PF01699.30`	Na_Ca_ex	113	268	3.9e-46	157.5
LXL04_032251	`PF01699.30`	Na_Ca_ex	302	444	3.9e-46	157.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39254`	Arabidopsis thaliana	Vacuolar cation/proton exchanger 2	68.322%	Swiss-Prot	strong database homology
`Q8L783`	Arabidopsis thaliana	Vacuolar cation/proton exchanger 5	66.213%	Swiss-Prot	strong database homology
`Q9LFZ8`	Arabidopsis thaliana	Putative vacuolar cation/proton exchanger 6	66.830%	Swiss-Prot	strong database homology
`Q5KQN0`	Oryza sativa subsp. japonica	Vacuolar cation/proton exchanger 2	69.912%	Swiss-Prot	strong database homology
`Q6K1C4`	Oryza sativa subsp. japonica	Vacuolar cation/proton exchanger 3	71.883%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card