LXL04_031878 | RubberDandelionOmics

Gene overview

LXL04_031878

Reference: OH-1004 Chr: Chr07 Coordinates: 12501769-12504720 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1632 bp · LXL04_031878|LXL04_031878|OH1004|cDNA

ATGGGTTTGAATATGGGCCTTGGAATATTAAATGGCCCATATTTTGTTACGGAAAACTGTGAAGCGCCCCTGACACTTAACCGGCTGAAGCACCACCCAGAATTTGCCGAGAGCGACGGCGGATGGCAGAGGAGGAGAAAGGGGAATTTACAGATGGCGGAAACCGAAGAACACCATTCTCAAGAAAATGAAGATTCATTTCAATGGGATGAACAGTCACAGTTGTATTACCATGCCAGTAGTGGATTCTATCATGATCC...

CDS

Download CDS FASTA

1632 bp · LXL04_031878|LXL04_031878|OH1004|CDS

ATGGGTTTGAATATGGGCCTTGGAATATTAAATGGCCCATATTTTGTTACGGAAAACTGTGAAGCGCCCCTGACACTTAACCGGCTGAAGCACCACCCAGAATTTGCCGAGAGCGACGGCGGATGGCAGAGGAGGAGAAAGGGGAATTTACAGATGGCGGAAACCGAAGAACACCATTCTCAAGAAAATGAAGATTCATTTCAATGGGATGAACAGTCACAGTTGTATTACCATGCCAGTAGTGGATTCTATCATGATCC...

Protein

Download Protein FASTA

543 aa · LXL04_031878|LXL04_031878|OH1004|PROTEIN

MGLNMGLGILNGPYFVTENCEAPLTLNRLKHHPEFAESDGGWQRRRKGNLQMAETEEHHSQENEDSFQWDEQSQLYYHASSGFYHDPAAGWYYSSNDGLYYKFENGSYVPWETDQADESNANQDIVTVGDKSDHDQSYKHAPCNTDTNDLKLEDGEIEGYVVEESTPNEPTVDTDSFTNGLPENLPPPSEWLEDTLIELYLSNYSNKTTDTASGTMPLDDDTGSNPPANGIVDNDDAYELEEGEWVPDDPHEIVDGNTVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031878`
TK1151 ID	TkA08G133750
OH-1004 ID	LXL04_031878
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 96.317 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031878

Location Chr07:12501769-12504720 (-)

Description Similar to SUA: SUPPRESSOR OF ABI3-5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54230`	Splicing factor that controls alternative splicing of the developmental regulator ABI3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031878 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G54230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.775

Rank 1 · LXL04_031878 · OH-1004

Cytoplasm0.282

Rank 2 · LXL04_031878 · OH-1004

Cell membrane0.043

Rank 3 · LXL04_031878 · OH-1004

Mitochondrion0.033

Rank 4 · LXL04_031878 · OH-1004

Endoplasmic reticulum0.028

Rank 5 · LXL04_031878 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17780.7OCRE67-111 aa

PF01585.29G-patch493-531 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031878	`PF17780.7`	OCRE	67	111	1.6e-08	35.1
LXL04_031878	`PF01585.29`	G-patch	493	531	6.7e-11	42.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JCU0`	Arabidopsis thaliana	SUPPRESSOR OF ABI3-5	37.069%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card