LXL04_031813 | RubberDandelionOmics

Gene overview

LXL04_031813

Reference: OH-1004 Chr: Chr07 Coordinates: 11648367-11651133 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1356 bp · LXL04_031813|LXL04_031813|OH1004|cDNA

ATGGATAACACAGCCCTTTACGCTTCTTCTCAAAAGCTAGTATTAGGTTTTACTACAAACCCTCGAAGCGATGGTTTAATCACCAATAAACCCTTGTTTTGCTCGTTCAAACTCCCAAAGAGAAGCGGCGTGCTCTCCAAATCCACAACTTCAATCTCCGCCGTGTCTCAGCCGCAAGGCTCAACCCCAAGAGCAATTGATAAATCAAATGAGAGGCTCGGGAAGGACTGTTTTGCTAGAATTTCTCCTTCAAGCAACCA...

CDS

Download CDS FASTA

1356 bp · LXL04_031813|LXL04_031813|OH1004|CDS

ATGGATAACACAGCCCTTTACGCTTCTTCTCAAAAGCTAGTATTAGGTTTTACTACAAACCCTCGAAGCGATGGTTTAATCACCAATAAACCCTTGTTTTGCTCGTTCAAACTCCCAAAGAGAAGCGGCGTGCTCTCCAAATCCACAACTTCAATCTCCGCCGTGTCTCAGCCGCAAGGCTCAACCCCAAGAGCAATTGATAAATCAAATGAGAGGCTCGGGAAGGACTGTTTTGCTAGAATTTCTCCTTCAAGCAACCA...

Protein

Download Protein FASTA

451 aa · LXL04_031813|LXL04_031813|OH1004|PROTEIN

MDNTALYASSQKLVLGFTTNPRSDGLITNKPLFCSFKLPKRSGVLSKSTTSISAVSQPQGSTPRAIDKSNERLGKDCFARISPSSNQQTSSVGTPQIAVPPPSSQVGSPLFWIGVGVAFSAAFSMAASFLKKYAMQQAFKTMMGQMDSQNNQFTNSNSGFSPGSPFPFPPPQMPGSTATSSPFPFPTPPPPPSTATSGPASQRTVTVDMPPTKTESPPASKTSIDDLEPPKEPKKSAFVDVSPEETLKTSPFENFKESYD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031813`
TK1151 ID	TkA08G131150
OH-1004 ID	LXL04_031813
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031813

Location Chr07:11648367-11651133 (-)

Description Similar to TIC40: Protein TIC 40, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16620`	Involved in protein precursor import into chloroplasts.	Tic40, a membrane-anchored co-chaperone homolog in the chloroplast protein translocon.2003 · DOI: 10.1093/emboj/cdg281 In vivo studies on the roles of Tic110, Tic40 and Hsp93 during chloroplast protein import.2005 · DOI: 10.1111/j.1365-313x.2004.02307.x Functional similarity between the chloroplast translocon component, Tic40, and the human co-chaperone, Hsp70-interacting protein (Hip).2007 · DOI: 10.1074/jbc.m611545200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031813 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031897 Tic complex Cellular Component

KEGG gene cross-reference

ath:AT5G16620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.952

Rank 1 · LXL04_031813 · OH-1004

Mitochondrion0.056

Rank 2 · LXL04_031813 · OH-1004

Nucleus0.035

Rank 3 · LXL04_031813 · OH-1004

Cytoplasm0.033

Rank 4 · LXL04_031813 · OH-1004

Peroxisome0.015

Rank 5 · LXL04_031813 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16550.11RPN13_C300-374 aa

PF17830.7STI1-HOP_DP389-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031813	`PF16550.11`	RPN13_C	300	374	3.6e-06	27.8
LXL04_031813	`PF17830.7`	STI1-HOP_DP	389	440	1.4e-11	44.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMD5`	Arabidopsis thaliana	Protein TIC 40, chloroplastic	54.076%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card