LXL04_031769 | RubberDandelionOmics

Gene overview

LXL04_031769

Reference: OH-1004 Chr: Chr07 Coordinates: 11099174-11100226 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · LXL04_031769|LXL04_031769|OH1004|cDNA

ATGGGCCCTACTCTTTTGGACGCACTCAATGTCCGAGTAGTTGGCTCCGGCAAGAAGTTCATGGTTCTGGCGCACGGATTGGGCACCGATCAGTCTGTGTGGAGTCGCATTCTCCCCTACTTCCGCTCTCACTACAGAGTCATCCTCTACGACCTTGTCTTCGCCGGCAGCGTTAACCCTGACTACTTCGATTTCAATCGCTACAACTCTCTAGACGCCTATGTCGACGACCTCCTCCAAATCCTTGACTCTCTCGGTGT...

CDS

Download CDS FASTA

834 bp · LXL04_031769|LXL04_031769|OH1004|CDS

ATGGGCCCTACTCTTTTGGACGCACTCAATGTCCGAGTAGTTGGCTCCGGCAAGAAGTTCATGGTTCTGGCGCACGGATTGGGCACCGATCAGTCTGTGTGGAGTCGCATTCTCCCCTACTTCCGCTCTCACTACAGAGTCATCCTCTACGACCTTGTCTTCGCCGGCAGCGTTAACCCTGACTACTTCGATTTCAATCGCTACAACTCTCTAGACGCCTATGTCGACGACCTCCTCCAAATCCTTGACTCTCTCGGTGT...

Protein

Download Protein FASTA

277 aa · LXL04_031769|LXL04_031769|OH1004|PROTEIN

MGPTLLDALNVRVVGSGKKFMVLAHGLGTDQSVWSRILPYFRSHYRVILYDLVFAGSVNPDYFDFNRYNSLDAYVDDLLQILDSLGVDRCYYVGHSLSSMIGILAAIRRPELFSKLILVGASPRYEICYGDGDLWFLNDKDYHGGFEEGEVEKVFLAMESNYEAWVNGFAPLAVGADVPTAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVKVPCCIIQTAKDVSVPTSVATYLKEHLGGRNTVEMMNVEGHLPH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031769`
TK1151 ID	TkA08G129230
OH-1004 ID	LXL04_031769
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031769

Location Chr07:11099174-11100226 (-)

Description Similar to DAD2: Probable strigolactone esterase DAD2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03990`	Involved in strigolactone signaling pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0203200`	Involved in strigolactone (SL) signaling pathway.	Identification and characterization of HTD2: a novel gene negatively regulating tiller bud outgrowth in rice.2009 · DOI: 10.1007/s00425-009-0975-6
`UniProt: Q10J20`	May be involved in strigolactone signaling pathway (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031769 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010223 secondary shoot formation Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0080167 response to karrikin Biological Process

GO:1901601 strigolactone biosynthetic process Biological Process

GO:1902348 cellular response to strigolactone Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT3G03990

dosa:Os03g0203200

dosa:Os03g0437600

osa:4333199

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.658

Rank 1 · LXL04_031769 · OH-1004

Nucleus0.404

Rank 2 · LXL04_031769 · OH-1004

Lysosome / Vacuole0.057

Rank 3 · LXL04_031769 · OH-1004

Cell membrane0.055

Rank 4 · LXL04_031769 · OH-1004

Peroxisome0.054

Rank 5 · LXL04_031769 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00561.27Abhydrolase_121-124 aa

PF12697.14Abhydrolase_621-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031769	`PF00561.27`	Abhydrolase_1	21	124	1.1e-14	55.4
LXL04_031769	`PF12697.14`	Abhydrolase_6	21	265	6.7e-13	50.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SQR3`	Arabidopsis thaliana	Strigolactone esterase D14	74.359%	Swiss-Prot	strong database homology
`Q10QA5`	Oryza sativa subsp. japonica	Strigolactone esterase D14	67.399%	Swiss-Prot	strong database homology
`Q10J20`	Oryza sativa subsp. japonica	Probable esterase D14L	56.154%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card