LXL04_031722 | RubberDandelionOmics

Gene overview

LXL04_031722

Reference: OH-1004 Chr: Chr07 Coordinates: 10232126-10234543 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2418 bp · LXL04_031722|LXL04_031722|OH1004|cDNA

ATGGATCTTCTGTTTCGTCTTCTCATGCTTGTTTCAGTAATCGTACACCAAACACCATTAACAAcctcatcatcttcttcatcttcaccACCACATGCTTTAAACCTAGGCTCGTCTCTCTCAGTAGACGACAAAACTGACGTCTTAATCTCACCTGACCATGTTTTCACTGCCGGATTCTACCCAGTCGGAGAAAATGCTTTTTGCTTCTCAATATGGTTCACTAAACCGTTATCCACCGGACGCCATACAGTCGTCTG...

CDS

Download CDS FASTA

2418 bp · LXL04_031722|LXL04_031722|OH1004|CDS

ATGGATCTTCTGTTTCGTCTTCTCATGCTTGTTTCAGTAATCGTACACCAAACACCATTAACAACCTCATCATCTTCTTCATCTTCACCACCACATGCTTTAAACCTAGGCTCGTCTCTCTCAGTAGACGACAAAACTGACGTCTTAATCTCACCTGACCATGTTTTCACTGCCGGATTCTACCCAGTCGGAGAAAATGCTTTTTGCTTCTCAATATGGTTCACTAAACCGTTATCCACCGGACGCCATACAGTCGTCTG...

Protein

Download Protein FASTA

805 aa · LXL04_031722|LXL04_031722|OH1004|PROTEIN

MDLLFRLLMLVSVIVHQTPLTTSSSSSSSPPHALNLGSSLSVDDKTDVLISPDHVFTAGFYPVGENAFCFSIWFTKPLSTGRHTVVWMANRDSPVNGRRSKLSLSKTGNLILQDADQELPIWTTRTRDLTDSAQLKLNNSGNLYLQSNDRRILWQSFGSPTDTLLPNQPLTKEAMLISSRSKTNYSSGFYRLFFDSDNVLRLVYSGPFVTGVYWPNPELRAWDAGRSTYGNQRTAAIDPFGRFISSDGWFFNTSDDGVQP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031722`
TK1151 ID	TkA08G125960
OH-1004 ID	LXL04_031722
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 52.919 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031722

Location Chr07:10232126-10234543 (-)

Description Similar to PK1: Putative receptor protein kinase ZmPK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24080`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080.	No verified direct reference in this release
`At2g19130`	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130.	No verified direct reference in this release
`At4g00340`	Serine/threonine-protein kinase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XQD3`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031722 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0051707 response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G19130

ath:AT4G00340

ath:AT5G24080

zma:542378

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.857

Rank 1 · LXL04_031722 · OH-1004

Endoplasmic reticulum0.083

Rank 2 · LXL04_031722 · OH-1004

Cytoplasm0.068

Rank 3 · LXL04_031722 · OH-1004

Nucleus0.036

Rank 4 · LXL04_031722 · OH-1004

Lysosome / Vacuole0.030

Rank 5 · LXL04_031722 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453.31B_lectin84-172 aa

PF00954.26S_locus_glycop260-321 aa

PF07714.24PK_Tyr_Ser-Thr525-799 aa

PF00069.32Pkinase526-797 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031722	`PF01453.31`	B_lectin	84	172	2.1e-23	83.4
LXL04_031722	`PF00954.26`	S_locus_glycop	260	321	4.7e-08	34.3
LXL04_031722	`PF07714.24`	PK_Tyr_Ser-Thr	525	799	6e-40	137.9
LXL04_031722	`PF00069.32`	Pkinase	526	797	1.8e-47	162.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLV4`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080	31.159%	Swiss-Prot	moderate database homology
`O64477`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130	31.218%	Swiss-Prot	moderate database homology
`Q39203`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2	31.847%	Swiss-Prot	moderate database homology
`A2XQD3`	Oryza sativa subsp. indica	G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2	30.488%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card