LXL04_031442 | RubberDandelionOmics

Gene overview

LXL04_031442

Reference: OH-1004 Chr: Chr07 Coordinates: 6028741-6030644 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1335 bp · LXL04_031442|LXL04_031442|OH1004|cDNA

ATGGAATTTAAATCTTCTGTTTGTATTGCAAATCAACTGGTACACTACAATTTTCAACGATCTCCCTTTGCCTTCCATGAACAATCGCCGGTTGCCACACCTTCAATGCAGTCGAAGCTTCCTTCACTTTCTGCAAATTCATCACATAGTTCATGTCCTGAAAACATTTACTTTCATTTCATTGCATCGGAATCGAAATCCCCAAAACCAGATGAGTTGTCACGGATCATCAAAACTGTGTTTCCGTCTCTGGATTTTAA...

CDS

Download CDS FASTA

1335 bp · LXL04_031442|LXL04_031442|OH1004|CDS

ATGGAATTTAAATCTTCTGTTTGTATTGCAAATCAACTGGTACACTACAATTTTCAACGATCTCCCTTTGCCTTCCATGAACAATCGCCGGTTGCCACACCTTCAATGCAGTCGAAGCTTCCTTCACTTTCTGCAAATTCATCACATAGTTCATGTCCTGAAAACATTTACTTTCATTTCATTGCATCGGAATCGAAATCCCCAAAACCAGATGAGTTGTCACGGATCATCAAAACTGTGTTTCCGTCTCTGGATTTTAA...

Protein

Download Protein FASTA

444 aa · LXL04_031442|LXL04_031442|OH1004|PROTEIN

MEFKSSVCIANQLVHYNFQRSPFAFHEQSPVATPSMQSKLPSLSANSSHSSCPENIYFHFIASESKSPKPDELSRIIKTVFPSLDFKVYSFDDRFVKNLISYSIREALEDPLNYARIYLADILDSSVSRVIYLDSDIIVVDDIQKLWSVSLGPTTAIGAPVYCHANFIDRFCIEVLRTDSDFGNSLDTNNEISSICTPHFIIVAWLETPRDAGNCPQLTMAAEEEDEQRIVFGRSDGLIEWERLQLRPISDQFQFHSQSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031442`
TK1151 ID	TkA08G106940
OH-1004 ID	LXL04_031442
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 60.586 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031442

Location Chr07:6028741-6030644 (-)

Description Similar to GATL9: Probable galacturonosyltransferase-like 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28340`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g70090`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g24170`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g62660`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At4g02130`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031442 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0047262 polygalacturonate 4-alpha-galacturonosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G24170

ath:AT1G70090

ath:AT3G28340

ath:AT3G62660

ath:AT4G02130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.358

Rank 1 · LXL04_031442 · OH-1004

Endoplasmic reticulum0.265

Rank 2 · LXL04_031442 · OH-1004

Cytoplasm0.234

Rank 3 · LXL04_031442 · OH-1004

Cell membrane0.117

Rank 4 · LXL04_031442 · OH-1004

Mitochondrion0.089

Rank 5 · LXL04_031442 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01501.27Glyco_transf_845-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031442	`PF01501.27`	Glyco_transf_8	45	162	1e-13	52.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHD2`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 10	54.667%	Swiss-Prot	weak database homology
`O04536`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 9	51.205%	Swiss-Prot	weak database homology
`O48684`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 8	48.824%	Swiss-Prot	weak database homology
`Q8VYF4`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 7	59.350%	Swiss-Prot	weak database homology
`O04253`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 6	50.735%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card