LXL04_031381 | RubberDandelionOmics

Gene overview

LXL04_031381

Reference: OH-1004 Chr: Chr07 Coordinates: 5237365-5240743 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2196 bp · LXL04_031381|LXL04_031381|OH1004|cDNA

ATGTCCGACGAACCATCTTCGTCGCCGATCCATTGCGACGGCGAAACCAACGACCACAATAAAACTTCTGCAAGCAATAATAACGGAAGCAACGCTATAGTAAGGAGAGAGAGGCCGTCGCGCGCATGCACTGCTCGCTCCGCGGCTCGGCTCCACGCAGCTGCCGCCGCGGAAGCGGCAGTTGTGACCGTTGGAAGAAAGCAGAAGTCTAGACGGCGGCCTTCTCGGCGAGAaatagaggaggaagaagaggaggagga...

CDS

Download CDS FASTA

2196 bp · LXL04_031381|LXL04_031381|OH1004|CDS

ATGTCCGACGAACCATCTTCGTCGCCGATCCATTGCGACGGCGAAACCAACGACCACAATAAAACTTCTGCAAGCAATAATAACGGAAGCAACGCTATAGTAAGGAGAGAGAGGCCGTCGCGCGCATGCACTGCTCGCTCCGCGGCTCGGCTCCACGCAGCTGCCGCCGCGGAAGCGGCAGTTGTGACCGTTGGAAGAAAGCAGAAGTCTAGACGGCGGCCTTCTCGGCGAGAAATAGAGGAGGAAGAAGAGGAGGAGGA...

Protein

Download Protein FASTA

731 aa · LXL04_031381|LXL04_031381|OH1004|PROTEIN

MSDEPSSSPIHCDGETNDHNKTSASNNNGSNAIVRRERPSRACTARSAARLHAAAAAEAAVVTVGRKQKSRRRPSRREIEEEEEEEEPPSPPNPYSSIVTPLVREPPLSQLSRWSIRSMWELASILNFFNVFRPLLNIKVEFSVEEFETALITPNGTLSDIHIPLLKAIPPVTRMALGRNTWVTVLCRKLRDWWHWVAEGELPIVAAQGAEVETYNTLDPSIRVIILKALCDIRVEQEDIRGYIEDSIKHGVPLSAFRKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031381`
TK1151 ID	TkA08G104240
OH-1004 ID	LXL04_031381
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 89.831 / OH-1004 58.003 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031381

Location Chr07:5237365-5240743 (+)

Description Similar to DDR4: DDT domain-containing protein DDR4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18950`	Probable transcription regulator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031381 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0007338 single fertilization Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0061640 cytoskeleton-dependent cytokinesis Biological Process

GO:0000791 euchromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0031010 ISWI-type complex Cellular Component

GO:0031213 RSF complex Cellular Component

KEGG gene cross-reference

ath:AT1G18950

hsa:27443

mmu:330409

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · LXL04_031381 · OH-1004

Cytoplasm0.107

Rank 2 · LXL04_031381 · OH-1004

Cell membrane0.018

Rank 3 · LXL04_031381 · OH-1004

Mitochondrion0.009

Rank 4 · LXL04_031381 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_031381 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02791.23DDT124-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031381	`PF02791.23`	DDT	124	169	6.5e-06	26.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IDY7`	Arabidopsis thaliana	DDT domain-containing protein DDR4	53.215%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card