LXL04_031275 | RubberDandelionOmics

Gene overview

LXL04_031275

Reference: OH-1004 Chr: Chr07 Coordinates: 3872883-3881006 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2676 bp · LXL04_031275|LXL04_031275|OH1004|cDNA

AtggcggcggcggcggcggcTACATGGCAACCCCAAGAAGGAGGGTTCAACGAGATCTGTGGGTTACTAGAGCAACAGATTTCTCCTTCTTCCGATAAATCTCAGATATGGCAGCAGCTCCAGCGCTACTCTCATATTCCCGATTTCAATAATTACCTCGCCTTCATCCTAGCACGCGCCGAGGGTAAACCAGTGGAGGTTCGACAGGCAGCTGGATTATTTCTGAAAAACAATCTCAAAACTGCATTCAAATCCATGAC...

CDS

Download CDS FASTA

2676 bp · LXL04_031275|LXL04_031275|OH1004|CDS

ATGGCGGCGGCGGCGGCGGCTACATGGCAACCCCAAGAAGGAGGGTTCAACGAGATCTGTGGGTTACTAGAGCAACAGATTTCTCCTTCTTCCGATAAATCTCAGATATGGCAGCAGCTCCAGCGCTACTCTCATATTCCCGATTTCAATAATTACCTCGCCTTCATCCTAGCACGCGCCGAGGGTAAACCAGTGGAGGTTCGACAGGCAGCTGGATTATTTCTGAAAAACAATCTCAAAACTGCATTCAAATCCATGAC...

Protein

Download Protein FASTA

891 aa · LXL04_031275|LXL04_031275|OH1004|PROTEIN

MAAAAAATWQPQEGGFNEICGLLEQQISPSSDKSQIWQQLQRYSHIPDFNNYLAFILARAEGKPVEVRQAAGLFLKNNLKTAFKSMTPINQAYIKAELLPCLGSADRQIRSTSGTIISVLVQLEGVLGWPELLHALVKCLDSNDLTHMEGAMDALSKICEDIPQVLDAENPGSSERPIDVFLPRLFQLFQSPHALLRKLALGCVNQYIMLMPPVLYMSMDSYLQGLFVLANDPSSEVRKLVCSAFVQLIEVRPSFLEPHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031275`
TK1151 ID	TkA08G099130
OH-1004 ID	LXL04_031275
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031275

Location Chr07:3872883-3881006 (-)

Description Similar to TRN1: Transportin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16950`	Functions in nuclear protein import as nuclear transport receptor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0691500`	Functions in nuclear protein import as nuclear transport receptor.	No verified direct reference in this release
`UniProt: B8ARW2`	Functions in nuclear protein import as nuclear transport receptor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031275 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006606 protein import into nucleus Biological Process

GO:0051170 import into nucleus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005929 cilium Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0008139 nuclear localization sequence binding Molecular Function

GO:0031267 small GTPase binding Molecular Function

KEGG gene cross-reference

ath:AT2G16950

dosa:Os04g0691500

hsa:3842

mmu:238799

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.771

Rank 1 · LXL04_031275 · OH-1004

Cytoplasm0.556

Rank 2 · LXL04_031275 · OH-1004

Cell membrane0.034

Rank 3 · LXL04_031275 · OH-1004

Mitochondrion0.033

Rank 4 · LXL04_031275 · OH-1004

Endoplasmic reticulum0.027

Rank 5 · LXL04_031275 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03810.26IBN_N37-104 aa

PF25780.2TPR_IPO5124-265 aa

PF25757.2TPR_DNAAF5383-502 aa

PF13646.13HEAT_2399-502 aa

PF13513.13HEAT_EZ406-460 aa

PF25574.2TPR_IMB1490-695 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031275	`PF03810.26`	IBN_N	37	104	2.7e-13	50.4
LXL04_031275	`PF25780.2`	TPR_IPO5	124	265	1.2e-17	65.4
LXL04_031275	`PF25757.2`	TPR_DNAAF5	383	502	2.9e-11	43.8
LXL04_031275	`PF13646.13`	HEAT_2	399	502	2.3e-12	47.8
LXL04_031275	`PF13513.13`	HEAT_EZ	406	460	1.3e-37	128.3
LXL04_031275	`PF25574.2`	TPR_IMB1	490	695	2.6e-12	46.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0U4`	Arabidopsis thaliana	Transportin-1	75.645%	Swiss-Prot	strong database homology
`B9FDR3`	Oryza sativa subsp. japonica	Transportin-1	74.270%	Swiss-Prot	strong database homology
`B8ARW2`	Oryza sativa subsp. indica	Transportin-1	74.128%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card