LXL04_030994 | RubberDandelionOmics

Gene overview

LXL04_030994

Reference: OH-1004 Chr: Chr06 Coordinates: 126413983-126420054 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3798 bp · LXL04_030994|LXL04_030994|OH1004|cDNA

ATGAGCAAACACGGCCACcaagacgaagaagaagaagaagaagaagataacaacagcaacagcaacgAGTGTTTCTACGAGTCGCTTGATCGTATACTCTCTTCCACCACTTGCTCGTCTTCTTCGTGCTCCTCTGCTTGTTCGGACAACGAAGATGATGACGTAGGTGATCGGAATTGGAGTGGTGGTTGTGATTACTATGCTTTGGCACGCCCGTTGCCTATCCCTAAATTTCCAATGGGCGTTGCTAATAATTACGA...

CDS

Download CDS FASTA

3798 bp · LXL04_030994|LXL04_030994|OH1004|CDS

ATGAGCAAACACGGCCACCAAGACGAAGAAGAAGAAGAAGAAGAAGATAACAACAGCAACAGCAACGAGTGTTTCTACGAGTCGCTTGATCGTATACTCTCTTCCACCACTTGCTCGTCTTCTTCGTGCTCCTCTGCTTGTTCGGACAACGAAGATGATGACGTAGGTGATCGGAATTGGAGTGGTGGTTGTGATTACTATGCTTTGGCACGCCCGTTGCCTATCCCTAAATTTCCAATGGGCGTTGCTAATAATTACGA...

Protein

Download Protein FASTA

1265 aa · LXL04_030994|LXL04_030994|OH1004|PROTEIN

MSKHGHQDEEEEEEEDNNSNSNECFYESLDRILSSTTCSSSSCSSACSDNEDDDVGDRNWSGGCDYYALARPLPIPKFPMGVANNYDVWISRPSSVDERRMRLLRQMGLARHKPSLSSSSDAAVAKFGKFGFADQLGGRTHQVPSNSGIIRSKSADHEHCNSSSHLDPYHEILSINSFSPPVSDTLPTKTVINNVDNHIQIESRNRSSSLVVSSNASIPSKLIHRSEDIIICDDYTANNHPNLNITSNSEVAETALDSIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030994`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030994

Location Chr06:126413983-126420054 (+)

Description Similar to POR1: Protochlorophyllide reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54190`	Phototransformation of protochlorophyllide (Pchlide) to chlorophyllide (Chlide).	Arabidopsis protochlorophyllide oxidoreductase A (PORA) restores bulk chlorophyll synthesis and normal development to a porB porC double mutant.2010 · DOI: 10.1007/s11103-009-9582-y Arabidopsis light-dependent protochlorophyllide oxidoreductase A (PORA) is essential for normal plant growth and development.2012 · DOI: 10.1007/s11103-012-9873-6

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030994 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009640 photomorphogenesis Biological Process

GO:0009647 skotomorphogenesis Biological Process

GO:0009723 response to ethylene Biological Process

GO:0015979 photosynthesis Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0016630 protochlorophyllide reductase activity Molecular Function

KEGG gene cross-reference

ath:AT5G54190

csv:101208554

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.313

Rank 1 · LXL04_030994 · OH-1004

Cytoplasm0.238

Rank 2 · LXL04_030994 · OH-1004

Nucleus0.233

Rank 3 · LXL04_030994 · OH-1004

Plastid0.200

Rank 4 · LXL04_030994 · OH-1004

Endoplasmic reticulum0.082

Rank 5 · LXL04_030994 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25172.2Beta-prop_WDR3_2nd419-652 aa

PF25174.2Beta-prop_THOC3420-462 aa

PF00400.39WD40426-460 aa

PF25175.2Beta-prop_WDR5429-462 aa

PF25175.2Beta-prop_WDR5520-741 aa

PF25173.2Beta-prop_WDR3_1st525-606 aa

PF24805.2EIF3I525-728 aa

PF00400.39WD40527-562 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030994	`PF25172.2`	Beta-prop_WDR3_2nd	419	652	8.4e-19	68.6
LXL04_030994	`PF25174.2`	Beta-prop_THOC3	420	462	7.4e-31	107.9
LXL04_030994	`PF00400.39`	WD40	426	460	5.8e-30	103.1
LXL04_030994	`PF25175.2`	Beta-prop_WDR5	429	462	9.2e-42	144.0
LXL04_030994	`PF25175.2`	Beta-prop_WDR5	520	741	9.2e-42	144.0
LXL04_030994	`PF25173.2`	Beta-prop_WDR3_1st	525	606	1.2e-25	91.0
LXL04_030994	`PF24805.2`	EIF3I	525	728	1.2e-13	51.7
LXL04_030994	`PF00400.39`	WD40	527	562	5.8e-30	103.1
LXL04_030994	`PF24814.2`	WD40_Prp19	527	653	2.5e-22	80.0
LXL04_030994	`PF24817.2`	WD40_WDHD1_1st	527	574	1.8e-20	74.0
LXL04_030994	`PF24807.2`	WD40_CDC20-Fz	527	612	1.7e-19	70.9
LXL04_030994	`PF25174.2`	Beta-prop_THOC3	530	575	7.4e-31	107.9
LXL04_030994	`PF24796.2`	WDR55	530	657	1.1e-11	45.0
LXL04_030994	`PF23381.2`	Beta-prop_IFT122_1st	531	743	2.3e-32	113.1
LXL04_030994	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	531	589	2.1e-17	64.2
LXL04_030994	`PF24105.2`	Beta-prop_CAF1B_HIR1	532	612	2.3e-17	63.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42536`	Arabidopsis thaliana	Protochlorophyllide reductase A, chloroplastic	76.296%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card