LXL04_030689 | RubberDandelionOmics

Gene overview

LXL04_030689

Reference: OH-1004 Chr: Chr06 Coordinates: 120830698-120836840 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2529 bp · LXL04_030689|LXL04_030689|OH1004|cDNA

ATGGGTGTTACCAAGGAAAATTGCCGGAACGAGCTCCGAGCTGCAATCCGTCAACTTACAGATCGCTGCCTGTACTCCGCCGCCAAATGGGCTGCGGAACAATTAGTAGGCATTGAGCAAGATCCGGCAAAGTACCCGCCTTCGCACACTCGATTACAGCGAGACTGTTCCAGCATTCGCCGCCGATTTCGCTCTACAGACGAGATAACCTCCACCCCAATCGCCGGCACATCATACGTCTCCACTCCTGTCCCGGAGGA...

CDS

Download CDS FASTA

2529 bp · LXL04_030689|LXL04_030689|OH1004|CDS

ATGGGTGTTACCAAGGAAAATTGCCGGAACGAGCTCCGAGCTGCAATCCGTCAACTTACAGATCGCTGCCTGTACTCCGCCGCCAAATGGGCTGCGGAACAATTAGTAGGCATTGAGCAAGATCCGGCAAAGTACCCGCCTTCGCACACTCGATTACAGCGAGACTGTTCCAGCATTCGCCGCCGATTTCGCTCTACAGACGAGATAACCTCCACCCCAATCGCCGGCACATCATACGTCTCCACTCCTGTCCCGGAGGA...

Protein

Download Protein FASTA

842 aa · LXL04_030689|LXL04_030689|OH1004|PROTEIN

MGVTKENCRNELRAAIRQLTDRCLYSAAKWAAEQLVGIEQDPAKYPPSHTRLQRDCSSIRRRFRSTDEITSTPIAGTSYVSTPVPEDDNEAVDSDFYLLAKTYFNCREYRRAAHVLSDQTGKKALFLRCYALYLAGEKRKEEETIELEGPLGKSDAINTELTSIERDLSTLRKNNTIDPFSLFLYGLVLKQKGDHTLAKTVLTESVNTYPWNWSAWEQLQSLSPTIETLNSLKLNNHYMKDFFLASSYHELRLHTQSLSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030689`
TK1151 ID	TkA07G423430
OH-1004 ID	LXL04_030689
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 94.444 / OH-1004 52.494 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030689

Location Chr06:120830698-120836840 (-)

Description Similar to APC8: Anaphase-promoting complex subunit 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48150`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030689 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0007091 metaphase/anaphase transition of mitotic cell cycle Biological Process

GO:0007096 regulation of exit from mitosis Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0045842 positive regulation of mitotic metaphase/anaphase transition Biological Process

GO:0051301 cell division Biological Process

KEGG gene cross-reference

ath:AT3G48150

bta:512651

ddi:DDB_G0272775

hsa:8697

mmu:52563

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.515

Rank 1 · LXL04_030689 · OH-1004

Cytoplasm0.365

Rank 2 · LXL04_030689 · OH-1004

Plastid0.056

Rank 3 · LXL04_030689 · OH-1004

Mitochondrion0.048

Rank 4 · LXL04_030689 · OH-1004

Cell membrane0.047

Rank 5 · LXL04_030689 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04049.20ANAPC88-279 aa

PF00515.35TPR_1341-373 aa

PF13181.13TPR_8341-372 aa

PF29407.1CFAP70_TPR_C373-463 aa

PF13428.13TPR_14375-417 aa

PF13414.13TPR_11381-422 aa

PF13431.13TPR_17396-424 aa

PF23914.2TPR_CcmH_CycH404-512 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030689	`PF04049.20`	ANAPC8	8	279	1.1e-73	248.8
LXL04_030689	`PF00515.35`	TPR_1	341	373	1.6e-25	88.6
LXL04_030689	`PF13181.13`	TPR_8	341	372	3.4e-25	86.7
LXL04_030689	`PF29407.1`	CFAP70_TPR_C	373	463	1e-09	39.0
LXL04_030689	`PF13428.13`	TPR_14	375	417	1.4e-18	66.2
LXL04_030689	`PF13414.13`	TPR_11	381	422	4.6e-16	58.9
LXL04_030689	`PF13431.13`	TPR_17	396	424	5.6e-14	51.9
LXL04_030689	`PF23914.2`	TPR_CcmH_CycH	404	512	1.2e-07	32.4
LXL04_030689	`PF00515.35`	TPR_1	409	441	1.6e-25	88.6
LXL04_030689	`PF13966.12`	zf-RVT	672	738	9.3e-12	46.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STS3`	Arabidopsis thaliana	Anaphase-promoting complex subunit 8	72.300%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card