RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_030498
Reference: OH-1004 Chr: Chr06 Coordinates: 117341442-117346303 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1449 bp · LXL04_030498|LXL04_030498|OH1004|cDNA

ATGTTTGTTTTTGCAAGATTGATAGCTTCAAAAACAACCAAGGCCACATGCTCCAACCGCAGTGCTTTCACAACACTCCGAGCTGCCATGGGCGACCACCGTAGTAACAGTGGGGGTGCATTAGTAGGCAGCAGAGATGGAACAAACGACGATTATTTCGCCACAATTCATCACATCTCCAACATCGTCCGCCGTGACATCTACTTAGAAAGAACCCTAAACAAAATGTGCATTTCCCGCATCGTCAATTCCGAGCTTGT...

CDS

Download CDS FASTA

1449 bp · LXL04_030498|LXL04_030498|OH1004|CDS

ATGTTTGTTTTTGCAAGATTGATAGCTTCAAAAACAACCAAGGCCACATGCTCCAACCGCAGTGCTTTCACAACACTCCGAGCTGCCATGGGCGACCACCGTAGTAACAGTGGGGGTGCATTAGTAGGCAGCAGAGATGGAACAAACGACGATTATTTCGCCACAATTCATCACATCTCCAACATCGTCCGCCGTGACATCTACTTAGAAAGAACCCTAAACAAAATGTGCATTTCCCGCATCGTCAATTCCGAGCTTGT...

Protein

Download Protein FASTA

482 aa · LXL04_030498|LXL04_030498|OH1004|PROTEIN

MFVFARLIASKTTKATCSNRSAFTTLRAAMGDHRSNSGGALVGSRDGTNDDYFATIHHISNIVRRDIYLERTLNKMCISRIVNSELVYRVLRSCSNSGIESFRFFNWVRTQHPQYEPTTLEFEELLKILAKTRHWETMWKVAHQMKTQKLPISPSVVSFIIEHYGKNGLIDQAVELFNKSKNFNCTQTTEIYNSLLFALCEVKNFQGAYGLVRRMVRKGITPDKKTYSVLVNGWCTAGKMKEAQNFLEEMSQKGYNPPVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_030498
TK1151 IDTkA07G408380
OH-1004 IDLXL04_030498
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 99.571 / OH-1004 96.266
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_030498
LocationChr06:117341442-117346303 (-)
DescriptionSimilar to At5g18390: Pentatricopeptide repeat-containing protein At5g18390, mitochondrial
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g18390 Pentatricopeptide repeat-containing protein At5g18390, mitochondrial. No verified direct reference in this release
At1g74900 Required for the trans-splicing of intron 1 of the mitochondrial nad1 transcript encoding the ND1 subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I).
The pentatricopeptide repeat gene OTP43 is required for trans-splicing of the mitochondrial nad1 Intron 1 in Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.107.054841
At5g65820 Putative pentatricopeptide repeat-containing protein At5g65820. No verified direct reference in this release
At3g49730 Pentatricopeptide repeat-containing protein At3g49730. No verified direct reference in this release
At1g52640 Pentatricopeptide repeat-containing protein At1g52640, mitochondrial. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030498 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006397 mRNA processing Biological Process
GO:0008380 RNA splicing Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0003729 mRNA binding Molecular Function
KEGG gene cross-reference
ath:AT1G74900
ath:AT5G18390
ath:AT5G65820
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.755
Rank 1 · LXL04_030498 · OH-1004
Plastid0.137
Rank 2 · LXL04_030498 · OH-1004
Nucleus0.062
Rank 3 · LXL04_030498 · OH-1004
Cytoplasm0.026
Rank 4 · LXL04_030498 · OH-1004
Cell membrane0.010
Rank 5 · LXL04_030498 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29070.1MSC6_N114-249 aa
PF13041.13PPR_2190-235 aa
PF13812.13PPR_3211-258 aa
PF23276.3TPR_24214-319 aa
PF12854.14PPR_1218-251 aa
PF01535.27PPR226-254 aa
PF13041.13PPR_2265-306 aa
PF13041.13PPR_2294-339 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_030498PF29070.1MSC6_N1142492.4e-1763.8
LXL04_030498PF13041.13PPR_21902356.7e-48161.3
LXL04_030498PF13812.13PPR_32112581.1e-2383.8
LXL04_030498PF23276.3TPR_242143198e-1555.6
LXL04_030498PF12854.14PPR_12182514.2e-35119.9
LXL04_030498PF01535.27PPR2262542.5e-36122.1
LXL04_030498PF13041.13PPR_22653066.7e-48161.3
LXL04_030498PF13041.13PPR_22943396.7e-48161.3
LXL04_030498PF12854.14PPR_13243524.2e-35119.9
LXL04_030498PF13812.13PPR_33674101.1e-2383.8
LXL04_030498PF13041.13PPR_23694106.7e-48161.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q94JX6Arabidopsis thalianaPentatricopeptide repeat-containing protein At5g18390, mitochondrial64.115%Swiss-Protstrong database homology
Q9S7R4Arabidopsis thalianaPentatricopeptide repeat-containing protein At1g74900, mitochondrial25.908%Swiss-Protweak database homology
Q9FH87Arabidopsis thalianaPutative pentatricopeptide repeat-containing protein At5g6582025.909%Swiss-Protweak database homology
P0C8A0Arabidopsis thalianaPentatricopeptide repeat-containing protein At3g4973026.914%Swiss-Protweak database homology
Q9SSR6Arabidopsis thalianaPentatricopeptide repeat-containing protein At1g52640, mitochondrial26.076%Swiss-Protweak database homology

JBrowse

View in Genome Browser