LXL04_029816 | RubberDandelionOmics

Gene overview

LXL04_029816

Reference: OH-1004 Chr: Chr06 Coordinates: 101103260-101104457 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · LXL04_029816|LXL04_029816|OH1004|cDNA

ATGAATCATATGAATGGAACAATTGCGCCAGAGATGAAGAAGTTACCATTATTAGAACATCTTTTGTTGTCTCACAATGCTTTCACAGGTGAGACTCCGGAAGAAATTGGAGAGTGTGTTCATTTGGGGAGACTTGAATTGTCGTATAATAATTTCACTGGCGAAATACCTGAAAGCTTTGGGAAGTTAGTTAGTTTGAGGTCGCTTTACCTTAATAATAATAAGCTTTCAGGGGAGATACCTTCAAGTTTAGGTAACTA...

CDS

Download CDS FASTA

1083 bp · LXL04_029816|LXL04_029816|OH1004|CDS

ATGAATCATATGAATGGAACAATTGCGCCAGAGATGAAGAAGTTACCATTATTAGAACATCTTTTGTTGTCTCACAATGCTTTCACAGGTGAGACTCCGGAAGAAATTGGAGAGTGTGTTCATTTGGGGAGACTTGAATTGTCGTATAATAATTTCACTGGCGAAATACCTGAAAGCTTTGGGAAGTTAGTTAGTTTGAGGTCGCTTTACCTTAATAATAATAAGCTTTCAGGGGAGATACCTTCAAGTTTAGGTAACTA...

Protein

Download Protein FASTA

360 aa · LXL04_029816|LXL04_029816|OH1004|PROTEIN

MNHMNGTIAPEMKKLPLLEHLLLSHNAFTGETPEEIGECVHLGRLELSYNNFTGEIPESFGKLVSLRSLYLNNNKLSGEIPSSLGNYVGLADVNLTHNGFNGHIPPGLLSAMIHNAIFFRSPGFLAVFYVGMLTSVLLAAIYCVIGWQYLKRILSSNAEPETKSPPEMTQKFPRITYKELSEATNGFDEQRLLGSGDYGRVYLGSLPDGTQIAVKVLQLQTECQVLKRIRHRNLIRIITASGLPDFKALVLPYMANGSLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029816`
TK1151 ID	TkAUNG027250
OH-1004 ID	LXL04_029816
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.300
Protein coverage (%)	TK1151 99.357 / OH-1004 83.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029816

Location Chr06:101103260-101104457 (+)

Description Similar to At2g24130: Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24130`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q1MX30`	Receptor kinase that detects X.oryzae pv. oryzae protein Ax21 to promote innate immunity.	No verified direct reference in this release
`UniProt: B8BB68`	LRR receptor kinase involved in defense response.	No verified direct reference in this release
`Os08g0174700`	LRR receptor kinase involved in defense response.	Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield.2009 · DOI: 10.1111/j.1467-7652.2009.00444.x A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice.2011 · DOI: 10.1007/s10059-011-0178-4
`Os11g0569733`	Receptor kinase that detects X.oryzae pv. oryzae protein Ax21 to promote innate immunity.	Cleavage and nuclear localization of the rice XA21 immune receptor.2012 · DOI: 10.1038/ncomms1932

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029816 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G24130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.675

Rank 1 · LXL04_029816 · OH-1004

Endoplasmic reticulum0.135

Rank 2 · LXL04_029816 · OH-1004

Lysosome / Vacuole0.106

Rank 3 · LXL04_029816 · OH-1004

Cytoplasm0.096

Rank 4 · LXL04_029816 · OH-1004

Nucleus0.047

Rank 5 · LXL04_029816 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_841-98 aa

PF00069.32Pkinase188-265 aa

PF07714.24PK_Tyr_Ser-Thr190-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029816	`PF13855.13`	LRR_8	41	98	6.9e-07	29.6
LXL04_029816	`PF00069.32`	Pkinase	188	265	3.5e-07	30.6
LXL04_029816	`PF07714.24`	PK_Tyr_Ser-Thr	190	273	4.5e-07	30.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUI0`	Arabidopsis thaliana	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130	36.677%	Swiss-Prot	moderate database homology
`Q1MX30`	Oryza sativa subsp. indica	Receptor kinase-like protein Xa21	30.904%	Swiss-Prot	moderate database homology
`B8BB68`	Oryza sativa subsp. indica	LRR receptor kinase BAK1	32.039%	Swiss-Prot	moderate database homology
`Q6Z4U4`	Oryza sativa subsp. japonica	LRR receptor kinase BAK1	32.039%	Swiss-Prot	moderate database homology
`Q2R2D5`	Oryza sativa subsp. japonica	Receptor kinase-like protein Xa21	30.321%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card