LXL04_029509 | RubberDandelionOmics

Gene overview

LXL04_029509

Reference: OH-1004 Chr: Chr06 Coordinates: 92648667-92652906 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2814 bp · LXL04_029509|LXL04_029509|OH1004|cDNA

ATGCTTCCTACACAAATTGGGATACCTGATAAATTTGTATTACATGGGCCTTTTTCTTCCCAATCCAGCAATACGCTCCGTACCTCACTCCCTATCAAAACCCCCCTTAGAAATGATTATAGACGAATTGAATTCAGGAGAAAAAGACAGCATTTTCCCCATGCGTTCTTTCGAAAATCCGATTCGGATCAAAGTAATGATAATAGTCCACCACAAGATGATTTTGTAACTAGGGTTCTAAAGGAAAATCCTTGCCAGGT...

CDS

Download CDS FASTA

2814 bp · LXL04_029509|LXL04_029509|OH1004|CDS

ATGCTTCCTACACAAATTGGGATACCTGATAAATTTGTATTACATGGGCCTTTTTCTTCCCAATCCAGCAATACGCTCCGTACCTCACTCCCTATCAAAACCCCCCTTAGAAATGATTATAGACGAATTGAATTCAGGAGAAAAAGACAGCATTTTCCCCATGCGTTCTTTCGAAAATCCGATTCGGATCAAAGTAATGATAATAGTCCACCACAAGATGATTTTGTAACTAGGGTTCTAAAGGAAAATCCTTGCCAGGT...

Protein

Download Protein FASTA

937 aa · LXL04_029509|LXL04_029509|OH1004|PROTEIN

MLPTQIGIPDKFVLHGPFSSQSSNTLRTSLPIKTPLRNDYRRIEFRRKRQHFPHAFFRKSDSDQSNDNSPPQDDFVTRVLKENPCQVEPRYKIGDNLYTLKEKQNLGKKSHGSNSASEILKKLNLTGSNNNKSGDGVDYSQDVYLNDILRKSKGKLYVPEQIFVEELSEEAEFDNEFEMLPRMSFEDLQKSINTDMVQKITFKDEGAFGRKDLIVELKEIPGAKNLQRTKWSIKLTGNQVRTVLNEYNGPRYEIETQTMA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029509`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029509

Location Chr06:92648667-92652906 (-)

Description Similar to FTSHI1: Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23940`	Functions in chloroplast biogenesis and chloroplast division.	The distinctive roles of five different ARC genes in the chloroplast division process in Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00500.x FtsHi1/ARC1 is an essential gene in Arabidopsis that links chloroplast biogenesis and division.2012 · DOI: 10.1111/tpj.12001 FtsHi4 is essential for embryogenesis due to its influence on chloroplast development in Arabidopsis.2014 · DOI: 10.1371/journal.pone.0099741

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029509 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0010304 PSII associated light-harvesting complex II catabolic process Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0043572 plastid fission Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT4G23940

sth:STH3198

tle:Tlet_1535

tma:TM0580

tmi:THEMA_01765

tmm:Tmari_0578

tmw:THMA_0595

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.905

Rank 1 · LXL04_029509 · OH-1004

Mitochondrion0.080

Rank 2 · LXL04_029509 · OH-1004

Nucleus0.042

Rank 3 · LXL04_029509 · OH-1004

Cytoplasm0.029

Rank 4 · LXL04_029509 · OH-1004

Cell membrane0.021

Rank 5 · LXL04_029509 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00004.36AAA466-606 aa

PF17862.8AAA_lid_3629-671 aa

PF01434.25Peptidase_M41696-895 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029509	`PF00004.36`	AAA	466	606	5.3e-40	137.6
LXL04_029509	`PF17862.8`	AAA_lid_3	629	671	6.8e-06	26.3
LXL04_029509	`PF01434.25`	Peptidase_M41	696	895	2e-15	57.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22993`	Arabidopsis thaliana	Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic	69.204%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card