LXL04_029353 | RubberDandelionOmics

Gene overview

LXL04_029353

Reference: OH-1004 Chr: Chr06 Coordinates: 88235624-88238656 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2301 bp · LXL04_029353|LXL04_029353|OH1004|cDNA

ATGGCTTCATCAAATCCCCACACGGAAACCATACATGAAATCATGGCAACATACAAATCACTTCCACCACGACCTTCCATTGAAGAGCTTGAAGCAGCCATATCCGTAATCAAAACAGCCAACACCGAAGAAAAacagaaacttgatgaaatctCCATCCAAATATGCCCACAAGATGTCCCACCCCACCTCTTCTCTGTCCTCCAACAGGTTCGACAAACCATGGTCGTGTTTCAGTGCCAAGAACAAAGAAAAGAAGC...

CDS

Download CDS FASTA

2301 bp · LXL04_029353|LXL04_029353|OH1004|CDS

ATGGCTTCATCAAATCCCCACACGGAAACCATACATGAAATCATGGCAACATACAAATCACTTCCACCACGACCTTCCATTGAAGAGCTTGAAGCAGCCATATCCGTAATCAAAACAGCCAACACCGAAGAAAAACAGAAACTTGATGAAATCTCCATCCAAATATGCCCACAAGATGTCCCACCCCACCTCTTCTCTGTCCTCCAACAGGTTCGACAAACCATGGTCGTGTTTCAGTGCCAAGAACAAAGAAAAGAAGC...

Protein

Download Protein FASTA

766 aa · LXL04_029353|LXL04_029353|OH1004|PROTEIN

MASSNPHTETIHEIMATYKSLPPRPSIEELEAAISVIKTANTEEKQKLDEISIQICPQDVPPHLFSVLQQVRQTMVVFQCQEQRKEALHILHVDNTYQTFDELIQKASKCVLGDTQLDKEDDLKYPIGNLEKQQLITDESLLISNKIDKVESFKGFVKSSSSKSTVFPSGTEESEKLSMMKVAALIETIAKQDGKVLDLQSKLMENIEWLPVSLGKLSNITELNLSDNKIMALPTSITNLTALTKLDVHSNQLINLPNSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029353`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029353

Location Chr06:88235624-88238656 (+)

Description Similar to IRL5: Plant intracellular Ras-group-related LRR protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35470`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release
`At2g17440`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release
`At5g05850`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	PIRL1 and PIRL9, encoding members of a novel plant-specific family of leucine-rich repeat proteins, are essential for differentiation of microspores into pollen.2010 · DOI: 10.1007/s00425-010-1242-6 Effect of sporophytic PIRL9 genotype on post-meiotic expression of the Arabidopsis pirl1;pirl9 mutant pollen phenotype.2011 · DOI: 10.1007/s00425-010-1324-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0572300`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release
`Os08g0511700`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029353 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009555 pollen development Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G17440

ath:AT4G35470

ath:AT5G05850

dosa:Os08g0511700

dosa:Os10g0572300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.300

Rank 1 · LXL04_029353 · OH-1004

Cytoplasm0.300

Rank 2 · LXL04_029353 · OH-1004

Cell membrane0.243

Rank 3 · LXL04_029353 · OH-1004

Endoplasmic reticulum0.134

Rank 4 · LXL04_029353 · OH-1004

Mitochondrion0.079

Rank 5 · LXL04_029353 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14196-294 aa

PF13855.13LRR_8212-253 aa

PF13855.13LRR_8219-276 aa

PF12799.14LRR_4219-256 aa

PF13855.13LRR_8265-322 aa

PF23598.2LRR_14292-407 aa

PF23598.2LRR_14415-472 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029353	`PF23598.2`	LRR_14	196	294	1e-33	117.3
LXL04_029353	`PF13855.13`	LRR_8	212	253	1.2e-21	76.9
LXL04_029353	`PF13855.13`	LRR_8	219	276	1.2e-21	76.9
LXL04_029353	`PF12799.14`	LRR_4	219	256	9.2e-17	61.4
LXL04_029353	`PF13855.13`	LRR_8	265	322	1.2e-21	76.9
LXL04_029353	`PF23598.2`	LRR_14	292	407	1e-33	117.3
LXL04_029353	`PF23598.2`	LRR_14	415	472	1e-33	117.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVW8`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 4	46.429%	Swiss-Prot	moderate database homology
`Q5G5E0`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 5	45.161%	Swiss-Prot	moderate database homology
`Q9FFJ3`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 1	44.398%	Swiss-Prot	weak database homology
`Q8S7M7`	Oryza sativa subsp. japonica	Plant intracellular Ras-group-related LRR protein 5	50.188%	Swiss-Prot	moderate database homology
`Q6Z8P4`	Oryza sativa subsp. japonica	Plant intracellular Ras-group-related LRR protein 4	41.741%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card