LXL04_029248 | RubberDandelionOmics

Gene overview

LXL04_029248

Reference: OH-1004 Chr: Chr06 Coordinates: 84810349-84815373 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1833 bp · LXL04_029248|LXL04_029248|OH1004|cDNA

ATGATGAAGAGTGCTTACCGGAAAATGGATGAAGGCTGCCGGAAAAATAAGCTGCAACTCGCCGGAAAGAAGAGGAAGCAACAGCCGGCTGTAAACCTTTGGCCGGTCGCCGGAATCACAGAAAACGGAAGAGAAGAGGGCTGCCGGAGTGAAGAAGCGGGAGTCGCCGGAAACAGGAGGAAGAAAGCCGGATGTCGCCTAGAGTTTGGCTGGAGTGCTCGATCGAATGAAGTGGGAGGAAAGGAGGTAGTAGGGTTTGT...

CDS

Download CDS FASTA

1833 bp · LXL04_029248|LXL04_029248|OH1004|CDS

ATGATGAAGAGTGCTTACCGGAAAATGGATGAAGGCTGCCGGAAAAATAAGCTGCAACTCGCCGGAAAGAAGAGGAAGCAACAGCCGGCTGTAAACCTTTGGCCGGTCGCCGGAATCACAGAAAACGGAAGAGAAGAGGGCTGCCGGAGTGAAGAAGCGGGAGTCGCCGGAAACAGGAGGAAGAAAGCCGGATGTCGCCTAGAGTTTGGCTGGAGTGCTCGATCGAATGAAGTGGGAGGAAAGGAGGTAGTAGGGTTTGT...

Protein

Download Protein FASTA

610 aa · LXL04_029248|LXL04_029248|OH1004|PROTEIN

MMKSAYRKMDEGCRKNKLQLAGKKRKQQPAVNLWPVAGITENGREEGCRSEEAGVAGNRRKKAGCRLEFGWSARSNEVGGKEVVGFVSFNSCRTEKSVKERKKNGIRECLTPIVTRACYHSLLPILQGEIMVRLPFLAGRRVVSEWKRTLKYRKKGVKFQHRKIQLGEIKSATDNFNNNNIIGQGGFGKVYKGALSTSKGQIRVAFKRLDHYYGQGDPEFLKEIIMLSGFTHKNLISLLGFCDEDGEKILVYDGTMALCY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029248`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029248

Location Chr06:84810349-84815373 (-)

Description Similar to At5g39000: Putative receptor-like protein kinase At5g39000

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029248 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010038 response to metal ion Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G28680

ath:AT5G38990

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.473

Rank 1 · LXL04_029248 · OH-1004

Nucleus0.296

Rank 2 · LXL04_029248 · OH-1004

Cell membrane0.287

Rank 3 · LXL04_029248 · OH-1004

Endoplasmic reticulum0.070

Rank 4 · LXL04_029248 · OH-1004

Mitochondrion0.064

Rank 5 · LXL04_029248 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase177-252 aa

PF07714.24PK_Tyr_Ser-Thr179-252 aa

PF00069.32Pkinase257-419 aa

PF07714.24PK_Tyr_Ser-Thr268-421 aa

PF00069.32Pkinase516-598 aa

PF07714.24PK_Tyr_Ser-Thr518-599 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029248	`PF00069.32`	Pkinase	177	252	3.3e-45	155.3
LXL04_029248	`PF07714.24`	PK_Tyr_Ser-Thr	179	252	6.1e-48	164.1
LXL04_029248	`PF00069.32`	Pkinase	257	419	3.3e-45	155.3
LXL04_029248	`PF07714.24`	PK_Tyr_Ser-Thr	268	421	6.1e-48	164.1
LXL04_029248	`PF00069.32`	Pkinase	516	598	3.3e-45	155.3
LXL04_029248	`PF07714.24`	PK_Tyr_Ser-Thr	518	599	6.1e-48	164.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	42.574%	Swiss-Prot	weak database homology
`Q3E8W4`	Arabidopsis thaliana	Receptor-like protein kinase ANXUR2	44.079%	Swiss-Prot	weak database homology
`Q9FID9`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g38990	42.244%	Swiss-Prot	weak database homology
`Q9SR05`	Arabidopsis thaliana	Receptor-like protein kinase ANXUR1	42.951%	Swiss-Prot	weak database homology
`Q9SCZ4`	Arabidopsis thaliana	Receptor-like protein kinase FERONIA	42.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card