LXL04_029146 | RubberDandelionOmics

Gene overview

LXL04_029146

Reference: OH-1004 Chr: Chr06 Coordinates: 81862542-81867666 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3279 bp · LXL04_029146|LXL04_029146|OH1004|cDNA

ATGCCATCACCTCCTTCCAAAATTTCTTTTTTTGCAGTTTTTGATTATATAAAGTTGATTGATGAGAAAATGAGTAATCGGCCGAGTACGCGCAACAAGAACAAGAGGCCAAGATCGGATAACAATGCAGAAGTCGTATCTGAATTATACAGGAAAATTCACTTATCCAATGAAGTCTCAAAGGATGATATAAAGCAGTTATTTATGTTTGGAAAGCCAGTATGTCAAGGTTGCAGAGTAAACACAAAAGATAACCCCAA...

CDS

Download CDS FASTA

3279 bp · LXL04_029146|LXL04_029146|OH1004|CDS

ATGCCATCACCTCCTTCCAAAATTTCTTTTTTTGCAGTTTTTGATTATATAAAGTTGATTGATGAGAAAATGAGTAATCGGCCGAGTACGCGCAACAAGAACAAGAGGCCAAGATCGGATAACAATGCAGAAGTCGTATCTGAATTATACAGGAAAATTCACTTATCCAATGAAGTCTCAAAGGATGATATAAAGCAGTTATTTATGTTTGGAAAGCCAGTATGTCAAGGTTGCAGAGTAAACACAAAAGATAACCCCAA...

Protein

Download Protein FASTA

1092 aa · LXL04_029146|LXL04_029146|OH1004|PROTEIN

MPSPPSKISFFAVFDYIKLIDEKMSNRPSTRNKNKRPRSDNNAEVVSELYRKIHLSNEVSKDDIKQLFMFGKPVCQGCRVNTKDNPNCFCGLIPPSNGNRKSGLWQKTSEIVFSLGPDPSKDLRASLNTPAGLTNLGATCYANSILQFLYMNKSFREGVLCVEPEVLSKQPVLGQLARLFAQLHASKMAFIDSAPFIEALALDNGIQQDSHEFLTLLFSLLEQCLSSSQVSKARTVVQDLFRGGVSHVTKCSKCGNQSEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029146`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029146

Location Chr06:81862542-81867666 (-)

Description Similar to UBP26: Ubiquitin carboxyl-terminal hydrolase 26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49600`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	Control of DNA methylation and heterochromatic silencing by histone H2B deubiquitination.2007 · DOI: 10.1038/nature05864

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0192800`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`UniProt: A2XDG4`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029146 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0048316 seed development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005929 cilium Cellular Component

GO:0004197 cysteine-type endopeptidase activity Molecular Function

GO:0004843 cysteine-type deubiquitinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G49600

dosa:Os03g0192800

hsa:84196

rno:362636

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.745

Rank 1 · LXL04_029146 · OH-1004

Cytoplasm0.316

Rank 2 · LXL04_029146 · OH-1004

Mitochondrion0.055

Rank 3 · LXL04_029146 · OH-1004

Cell membrane0.041

Rank 4 · LXL04_029146 · OH-1004

Endoplasmic reticulum0.027

Rank 5 · LXL04_029146 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00443.36UCH131-463 aa

PF13423.13UCH_1131-405 aa

PF06337.18DUSP542-602 aa

PF06337.18DUSP647-709 aa

PF06337.18DUSP775-861 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029146	`PF00443.36`	UCH	131	463	4.5e-50	171.3
LXL04_029146	`PF13423.13`	UCH_1	131	405	1e-16	62.2
LXL04_029146	`PF06337.18`	DUSP	542	602	3.4e-20	73.0
LXL04_029146	`PF06337.18`	DUSP	647	709	3.4e-20	73.0
LXL04_029146	`PF06337.18`	DUSP	775	861	3.4e-20	73.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCJ9`	Arabidopsis thaliana	Ubiquitin carboxyl-terminal hydrolase 26	57.635%	Swiss-Prot	strong database homology
`A3AF13`	Oryza sativa subsp. japonica	Ubiquitin carboxyl-terminal hydrolase 26	58.287%	Swiss-Prot	strong database homology
`A2XDG4`	Oryza sativa subsp. indica	Ubiquitin carboxyl-terminal hydrolase 26	58.249%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card