LXL04_028757 | RubberDandelionOmics

Gene overview

LXL04_028757

Reference: OH-1004 Chr: Chr06 Coordinates: 61211707-61213825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1059 bp · LXL04_028757|LXL04_028757|OH1004|cDNA

ATGGCAGATGAAGAAGAACATCACGAAACAGAGCTCAGCGATAATCAGAAAATCGACATTGCCAAATGGTTTCTCCTCAATTCTCCCCCCGGTGAAATCCAATACGTTGCCAAAGATCTAAGATCGGTTTTAAGTGATGAGAACGTGTATCGAATGGCGGCTTCAGAGGCATTCCCCTTTTACAACAAAACGCACATTATTTCTCTCCAATTCCCAGATCGAAGTGGCGATGTGCTGGTTTCCTCATTTAGCGAGATCAG...

CDS

Download CDS FASTA

1059 bp · LXL04_028757|LXL04_028757|OH1004|CDS

ATGGCAGATGAAGAAGAACATCACGAAACAGAGCTCAGCGATAATCAGAAAATCGACATTGCCAAATGGTTTCTCCTCAATTCTCCCCCCGGTGAAATCCAATACGTTGCCAAAGATCTAAGATCGGTTTTAAGTGATGAGAACGTGTATCGAATGGCGGCTTCAGAGGCATTCCCCTTTTACAACAAAACGCACATTATTTCTCTCCAATTCCCAGATCGAAGTGGCGATGTGCTGGTTTCCTCATTTAGCGAGATCAG...

Protein

Download Protein FASTA

352 aa · LXL04_028757|LXL04_028757|OH1004|PROTEIN

MADEEEHHETELSDNQKIDIAKWFLLNSPPGEIQYVAKDLRSVLSDENVYRMAASEAFPFYNKTHIISLQFPDRSGDVLVSSFSEISEDEYLDPRTAQIAKVDHVKQICTDIRPAKDEELPTPYIEEYRCALDAEVCKYVAEAYPKGVCSVYCTRGKDVDEPGFDFQLVVLITATRLSPQNFWYQFLFIFFFIPISISISIFVTLVMEAGAQYGTSSSWTSYKLWKYEEKCKWVLTILKKGMSSLKRNMNARIQLCFRFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028757`
TK1151 ID	TkA07G207910
OH-1004 ID	LXL04_028757
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	67.800
Protein coverage (%)	TK1151 97.872 / OH-1004 78.125 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028757

Location Chr06:61211707-61213825 (-)

Description Similar to At3g05520: F-actin-capping protein subunit alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05520`	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028757 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0009617 response to bacterium Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0051016 barbed-end actin filament capping Biological Process

GO:0051693 actin filament capping Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008290 F-actin capping protein complex Cellular Component

GO:0030863 cortical cytoskeleton Cellular Component

GO:0030864 cortical actin cytoskeleton Cellular Component

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT3G05520

ddi:DDB_G0272104

dnm:101438046

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.468

Rank 1 · LXL04_028757 · OH-1004

Nucleus0.365

Rank 2 · LXL04_028757 · OH-1004

Mitochondrion0.158

Rank 3 · LXL04_028757 · OH-1004

Endoplasmic reticulum0.103

Rank 4 · LXL04_028757 · OH-1004

Cell membrane0.097

Rank 5 · LXL04_028757 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01267.23F-actin_cap_A21-183 aa

PF01267.23F-actin_cap_A278-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028757	`PF01267.23`	F-actin_cap_A	21	183	7.4e-55	187.0
LXL04_028757	`PF01267.23`	F-actin_cap_A	278	343	7.4e-55	187.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82631`	Arabidopsis thaliana	F-actin-capping protein subunit alpha	53.846%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card