LXL04_028510 | RubberDandelionOmics

Gene overview

LXL04_028510

Reference: OH-1004 Chr: Chr06 Coordinates: 43992838-43994672 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

924 bp · LXL04_028510|LXL04_028510|OH1004|cDNA

ATGGAGATAGAAAAAATTGATGAGGGTAAAGGACCCCGTGTATCTGGTGCTTACATCCGTAGCCTTGTGAAACACTTAACTGCCAAAGATCCGGCAGATGGTGGTAGTGGATCGCCGGAAAATGAGAATCAATTCAGCGACGATATTAGTAATAACCAAAAACAGCAAAAGCCCAAAAAACAAGTTAGAAGGAGACTCCACACCAGTAAGCCTTATCAAGAAAGACTCCTAAACATGGCTGAAGCTAGAAGAGAAATTGT...

CDS

Download CDS FASTA

924 bp · LXL04_028510|LXL04_028510|OH1004|CDS

ATGGAGATAGAAAAAATTGATGAGGGTAAAGGACCCCGTGTATCTGGTGCTTACATCCGTAGCCTTGTGAAACACTTAACTGCCAAAGATCCGGCAGATGGTGGTAGTGGATCGCCGGAAAATGAGAATCAATTCAGCGACGATATTAGTAATAACCAAAAACAGCAAAAGCCCAAAAAACAAGTTAGAAGGAGACTCCACACCAGTAAGCCTTATCAAGAAAGACTCCTAAACATGGCTGAAGCTAGAAGAGAAATTGT...

Protein

Download Protein FASTA

307 aa · LXL04_028510|LXL04_028510|OH1004|PROTEIN

MEIEKIDEGKGPRVSGAYIRSLVKHLTAKDPADGGSGSPENENQFSDDISNNQKQQKPKKQVRRRLHTSKPYQERLLNMAEARREIVTALKFHRASMKQQQTATAATNHHPLPVQERKPKSTTTTANLYWPITATAPPLPPAYNDNLNLFLPSQTLGLNLNFENFENLDSTCFYNTQLSMPSSSTSSSAPVAGKQTESYSGGLHHAMGDEEMEEIRLLGEKHQIEWNDTINLMTSARWCSFLKNMEMEEDEGDEFYGFDQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028510`
TK1151 ID	TkA07G164330
OH-1004 ID	LXL04_028510
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.700
Protein coverage (%)	TK1151 99.624 / OH-1004 94.788 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028510

Location Chr06:43992838-43994672 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g21280`	Required to regulate responses to abiotic stress (drought) and to oxidative stress leading to cell death.	Oxidative stress provokes distinct transcriptional responses in the stress-tolerant atr7 and stress-sensitive loh2 Arabidopsis thaliana mutants as revealed by multi-parallel quantitative real-time PCR analysis of ROS marker and antioxidant genes.2012 · DOI: 10.1016/j.plaphy.2012.05.024 A novel seed plants gene regulates oxidative stress tolerance in Arabidopsis thaliana.2020 · DOI: 10.1007/s00018-019-03202-5

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028510 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010555 response to mannitol Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:1901562 response to paraquat Biological Process

GO:1902882 regulation of response to oxidative stress Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · LXL04_028510 · OH-1004

Cytoplasm0.111

Rank 2 · LXL04_028510 · OH-1004

Cell membrane0.034

Rank 3 · LXL04_028510 · OH-1004

Endoplasmic reticulum0.029

Rank 4 · LXL04_028510 · OH-1004

Plastid0.015

Rank 5 · LXL04_028510 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30938.1ATR712-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028510	`PF30938.1`	ATR7	12	306	3.8e-102	342.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C589`	Arabidopsis thaliana	Protein AAL-toxin resistant 7	36.095%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card