LXL04_028204 | RubberDandelionOmics

Gene overview

LXL04_028204

Reference: OH-1004 Chr: Chr06 Coordinates: 34400437-34417110 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2937 bp · LXL04_028204|LXL04_028204|OH1004|cDNA

ATGCCAACATCATCAAACCTTGCTCTTGATGATTCATCAATCCCTCAACTTGAGCCACCTACCTATACATCAGATAGCTTTCTACATGCTTCAAATGCTAATGTTTGTAACTATGTTTCAATGAAGGTGTCTAATAACCACAGCTACCGTCTTTGGAAGAGACAAATTCTTTGCCTACTCAATATTCACAATATGGTTGCCCTCGTGGATGAGACAATGGACCGTCCCACAGCTTCAACCAATGAGATCATGACCAAATA...

CDS

Download CDS FASTA

2937 bp · LXL04_028204|LXL04_028204|OH1004|CDS

ATGCCAACATCATCAAACCTTGCTCTTGATGATTCATCAATCCCTCAACTTGAGCCACCTACCTATACATCAGATAGCTTTCTACATGCTTCAAATGCTAATGTTTGTAACTATGTTTCAATGAAGGTGTCTAATAACCACAGCTACCGTCTTTGGAAGAGACAAATTCTTTGCCTACTCAATATTCACAATATGGTTGCCCTCGTGGATGAGACAATGGACCGTCCCACAGCTTCAACCAATGAGATCATGACCAAATA...

Protein

Download Protein FASTA

978 aa · LXL04_028204|LXL04_028204|OH1004|PROTEIN

MPTSSNLALDDSSIPQLEPPTYTSDSFLHASNANVCNYVSMKVSNNHSYRLWKRQILCLLNIHNMVALVDETMDRPTASTNEIMTKYDSLLKGWIFGSISEALLTQVVDFGSAKDVWDKLILIYGPTMSSEIVKLSGPNYHIWKTQMLLLMKNYKIDGLVDYTIDGSIVSSKDTLEKRERLLKNWIVDSVSNDLLMDNIHLRPAKDIWDYLKWNYDSTLTSEIVKLSGQHNYHLWRTEMLYLVNSYNIDGVMDDTIDEAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028204`
TK1151 ID	TkA07G129740
OH-1004 ID	LXL04_028204
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 22.802 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028204

Location Chr06:34400437-34417110 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12360`	Involved in salt stress tolerance.	ITN1, a novel gene encoding an ankyrin-repeat protein that affects the ABA-mediated production of reactive oxygen species and is involved in salt-stress tolerance in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03614.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028204 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007219 Notch signaling pathway Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010803 regulation of tumor necrosis factor-mediated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003779 actin binding Molecular Function

KEGG gene cross-reference

ath:AT3G12360

hsa:142678

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.837

Rank 1 · LXL04_028204 · OH-1004

Endoplasmic reticulum0.087

Rank 2 · LXL04_028204 · OH-1004

Cytoplasm0.076

Rank 3 · LXL04_028204 · OH-1004

Nucleus0.036

Rank 4 · LXL04_028204 · OH-1004

Lysosome / Vacuole0.033

Rank 5 · LXL04_028204 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14223.15Retrotran_gag_260-125 aa

PF12796.14Ank_2346-424 aa

PF12796.14Ank_2382-461 aa

PF13962.12PGG791-904 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028204	`PF14223.15`	Retrotran_gag_2	60	125	2.4e-17	63.9
LXL04_028204	`PF12796.14`	Ank_2	346	424	9.1e-16	58.9
LXL04_028204	`PF12796.14`	Ank_2	382	461	9.1e-16	58.9
LXL04_028204	`PF13962.12`	PGG	791	904	1.2e-24	87.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7A2`	Arabidopsis thaliana	Ankyrin repeat-containing protein ITN1	26.087%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card