LXL04_028135 | RubberDandelionOmics

Gene overview

LXL04_028135

Reference: OH-1004 Chr: Chr06 Coordinates: 32211273-32213513 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1035 bp · LXL04_028135|LXL04_028135|OH1004|cDNA

ATGGCCTCAATCTCCTCTTCCTCTGTAAACCATTTATTCAGCCCTATTCATCATCGTAACTTATTAGTTCCTAAATCCCTTTCTTCTTTCAAGTATTCCCAGTTTAATTCTCCCATCCGATACCCATTTTCAAGAATTCAAGCGACTTCTGACCTCGTTGCTACAGTATCgGAAGCAATCACTCAACTCCAAGATTTGGGAGAGCACGATTTGTTTGCATGTCCTGTGTGTTTCGAGCCACTTATAAGAAAAGGTCCTCC...

CDS

Download CDS FASTA

1035 bp · LXL04_028135|LXL04_028135|OH1004|CDS

ATGGCCTCAATCTCCTCTTCCTCTGTAAACCATTTATTCAGCCCTATTCATCATCGTAACTTATTAGTTCCTAAATCCCTTTCTTCTTTCAAGTATTCCCAGTTTAATTCTCCCATCCGATACCCATTTTCAAGAATTCAAGCGACTTCTGACCTCGTTGCTACAGTATCGGAAGCAATCACTCAACTCCAAGATTTGGGAGAGCACGATTTGTTTGCATGTCCTGTGTGTTTCGAGCCACTTATAAGAAAAGGTCCTCC...

Protein

Download Protein FASTA

344 aa · LXL04_028135|LXL04_028135|OH1004|PROTEIN

MASISSSSVNHLFSPIHHRNLLVPKSLSSFKYSQFNSPIRYPFSRIQATSDLVATVSEAITQLQDLGEHDLFACPVCFEPLIRKGPPGFNLPAIYRSGFKCRKCNKTYSSKNIYLDLTVIAGAKDYVEIQPSRTELFRSPLVSFLYERGWRQNFNLRGFPGPDDEFDMAQEYFKPSEGGILVDVSCGSGLFSRKFAKSGIYSKVVALDFSENMLRQCYDFIKLDDTISSSNLALVRADVSRLPFASGSIDAVHAGAALHC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028135`
TK1151 ID	TkA07G123290
OH-1004 ID	LXL04_028135
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 99.709 / OH-1004 99.709 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028135

Location Chr06:32211273-32213513 (-)

Description Similar to At2g41040: Uncharacterized methyltransferase At2g41040, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41040`	Uncharacterized methyltransferase At2g41040, chloroplastic.	No verified direct reference in this release
`At1g78140`	Uncharacterized methyltransferase At1g78140, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028135 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009234 menaquinone biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0008168 methyltransferase activity Molecular Function

GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function

GO:0043770 demethylmenaquinone methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G78140

ath:AT2G41040

dsy:DSY1907

sab:SAB1333c

sam:MW1360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.976

Rank 1 · LXL04_028135 · OH-1004

Mitochondrion0.029

Rank 2 · LXL04_028135 · OH-1004

Nucleus0.024

Rank 3 · LXL04_028135 · OH-1004

Cytoplasm0.020

Rank 4 · LXL04_028135 · OH-1004

Peroxisome0.014

Rank 5 · LXL04_028135 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01209.25Ubie_methyltran175-288 aa

PF13489.13Methyltransf_23175-328 aa

PF13847.13Methyltransf_31178-287 aa

PF08241.19Methyltransf_11182-282 aa

PF13649.13Methyltransf_25182-279 aa

PF08242.19Methyltransf_12182-281 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028135	`PF01209.25`	Ubie_methyltran	175	288	3.7e-11	43.5
LXL04_028135	`PF13489.13`	Methyltransf_23	175	328	4.1e-11	43.6
LXL04_028135	`PF13847.13`	Methyltransf_31	178	287	1.5e-12	48.2
LXL04_028135	`PF08241.19`	Methyltransf_11	182	282	2.8e-21	76.7
LXL04_028135	`PF13649.13`	Methyltransf_25	182	279	1.7e-17	64.6
LXL04_028135	`PF08242.19`	Methyltransf_12	182	281	8.6e-11	43.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WPT7`	Arabidopsis thaliana	Uncharacterized methyltransferase At2g41040, chloroplastic	67.541%	Swiss-Prot	strong database homology
`Q8LBV4`	Arabidopsis thaliana	Uncharacterized methyltransferase At1g78140, chloroplastic	52.797%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card