LXL04_027370 | RubberDandelionOmics

Gene overview

LXL04_027370

Reference: OH-1004 Chr: Chr06 Coordinates: 14391185-14394722 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1278 bp · LXL04_027370|LXL04_027370|OH1004|cDNA

ATGGCGAAAGGCCCATCTTTTGCGTTTGTCAAATACCATAAATCTCGGGTTTCCTTTTCCATTTCTCTAACTCGCCAAAAGAGGAAAACTAATTTTCTCCTTTTTGCCGTCACGCTCGCCGGACGCCGGAGCACAGAATGGCCGGAAATGTCCGCCCCGGTTATAGACGGGAATGAAGCAGCAGCAGGCCACATCATATCAACAACAATCGGAGGCAAAAATGGTGAACCAAAACAGACAGTTAGTTACATGGCGGAACG...

CDS

Download CDS FASTA

1278 bp · LXL04_027370|LXL04_027370|OH1004|CDS

ATGGCGAAAGGCCCATCTTTTGCGTTTGTCAAATACCATAAATCTCGGGTTTCCTTTTCCATTTCTCTAACTCGCCAAAAGAGGAAAACTAATTTTCTCCTTTTTGCCGTCACGCTCGCCGGACGCCGGAGCACAGAATGGCCGGAAATGTCCGCCCCGGTTATAGACGGGAATGAAGCAGCAGCAGGCCACATCATATCAACAACAATCGGAGGCAAAAATGGTGAACCAAAACAGACAGTTAGTTACATGGCGGAACG...

Protein

Download Protein FASTA

425 aa · LXL04_027370|LXL04_027370|OH1004|PROTEIN

MAKGPSFAFVKYHKSRVSFSISLTRQKRKTNFLLFAVTLAGRRSTEWPEMSAPVIDGNEAAAGHIISTTIGGKNGEPKQTVSYMAERIVGTGSFGTVFQAKCIETGETVAIKKVLQDKRYKNRELQLMRAMDHPNLVTLKHCFYSTTSREELFLNLVMEYVPETISRVLKHYNDLRQNMPLVYVKLYTYQIFRGLAYMHTVAGVCHRDLKPQNVLVDPFTHQVKICDFGSAKMLVRGEANISYICSRFYRAPELIFGATE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027370`
TK1151 ID	TkA07G053350
OH-1004 ID	LXL04_027370
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 98.691 / OH-1004 88.706 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027370

Location Chr06:14391185-14394722 (+)

Description Similar to ASK7: Shaggy-related protein kinase eta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18710`	Negative regulator in brassinosteroid signal transduction pathway important for plant growth.	Regulation of brassinosteroid signaling by a GSK3/SHAGGY-like kinase.2002 · DOI: 10.1126/science.1065769 The GSK3-like kinase BIN2 phosphorylates and destabilizes BZR1, a positive regulator of the brassinosteroid signaling pathway in Arabidopsis.2002 · DOI: 10.1073/pnas.152342599 Two putative BIN2 substrates are nuclear components of brassinosteroid signaling.2002 · DOI: 10.1104/pp.102.010918 Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway.2012 · DOI: 10.1038/nature10794 SPEECHLESS integrates brassinosteroid and stomata signalling pathways.2012 · DOI: 10.1038/ncb2471 Brassinosteroid-regulated GSK3/Shaggy-like kinases phosphorylate mitogen-activated protein (MAP) kinase kinases, which control stomata development in Arabidopsis thaliana.2013 · DOI: 10.1074/jbc.m112.384453 BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175 POLAR-guided signalling complex assembly and localization drive asymmetric cell division.2018 · DOI: 10.1038/s41586-018-0714-x
`At2g30980`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At1g06390`	Phosphorylates BSK1, BSK3, BSK5, BSK6, BSK8 and BSK11 in vitro.	BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0207500`	Serine-threonine kinase that acts as a negative regulator of brassinosteroid (BR) signaling.	DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.2012 · DOI: 10.1105/tpc.112.097394 OVATE Family Protein 8 Positively Mediates Brassinosteroid Signaling through Interacting with the GSK3-like Kinase in Rice.2016 · DOI: 10.1371/journal.pgen.1006118 OsBZR1 turnover mediated by OsSK22-regulated U-box E3 ligase OsPUB24 in rice BR response.2019 · DOI: 10.1111/tpj.14332
`Os01g0205700`	Probable serine-threonine kinase that may act as a negative regulator of brassinosteroid (BR) signaling during flower development.	T-DNA tagged knockout mutation of rice OsGSK1, an orthologue of Arabidopsis BIN2, with enhanced tolerance to various abiotic stresses.2007 · DOI: 10.1007/s11103-007-9213-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027370 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007033 vacuole organization Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009729 detection of brassinosteroid stimulus Biological Process

GO:0009733 response to auxin Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010508 positive regulation of autophagy Biological Process

KEGG gene cross-reference

ath:AT1G06390

ath:AT2G30980

ath:AT4G18710

dosa:Os01g0205700

dosa:Os05g0207500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.617

Rank 1 · LXL04_027370 · OH-1004

Nucleus0.483

Rank 2 · LXL04_027370 · OH-1004

Cell membrane0.079

Rank 3 · LXL04_027370 · OH-1004

Mitochondrion0.051

Rank 4 · LXL04_027370 · OH-1004

Endoplasmic reticulum0.039

Rank 5 · LXL04_027370 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase84-367 aa

PF07714.24PK_Tyr_Ser-Thr86-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027370	`PF00069.32`	Pkinase	84	367	4.2e-62	210.6
LXL04_027370	`PF07714.24`	PK_Tyr_Ser-Thr	86	286	1.8e-26	93.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39011`	Arabidopsis thaliana	Shaggy-related protein kinase eta	84.267%	Swiss-Prot	strong database homology
`Q39010`	Arabidopsis thaliana	Shaggy-related protein kinase zeta	84.492%	Swiss-Prot	strong database homology
`Q39012`	Arabidopsis thaliana	Shaggy-related protein kinase iota	85.246%	Swiss-Prot	strong database homology
`Q60EZ2`	Oryza sativa subsp. japonica	Shaggy-related protein kinase GSK2	83.516%	Swiss-Prot	strong database homology
`Q9LWN0`	Oryza sativa subsp. japonica	Shaggy-related protein kinase GSK1	82.597%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card