LXL04_027200 | RubberDandelionOmics

Gene overview

LXL04_027200

Reference: OH-1004 Chr: Chr06 Coordinates: 10916838-10921091 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2166 bp · LXL04_027200|LXL04_027200|OH1004|cDNA

ATGGAGCATTCTAGATGGAAATCTTGTATGCTCGCTACTGTGGGTTTGATTTCAATTTTTACTGCTCACTTTTGCTTTGGAGACACCGATCCACGCGATATATTGGCAATAAATAGTCTATATGCTGCTCTTGGGTACCCCCCTCTTCCTGGGTGGTTAGTCTCAGGGGGTGACCCATGTGCTGAAGGTTGGCAAGGTGTTCAATGTGTCAACTCCAACATAACTGGAATAATTCTAAATGGTGCCAATTTGGGAGGTGA...

CDS

Download CDS FASTA

2166 bp · LXL04_027200|LXL04_027200|OH1004|CDS

ATGGAGCATTCTAGATGGAAATCTTGTATGCTCGCTACTGTGGGTTTGATTTCAATTTTTACTGCTCACTTTTGCTTTGGAGACACCGATCCACGCGATATATTGGCAATAAATAGTCTATATGCTGCTCTTGGGTACCCCCCTCTTCCTGGGTGGTTAGTCTCAGGGGGTGACCCATGTGCTGAAGGTTGGCAAGGTGTTCAATGTGTCAACTCCAACATAACTGGAATAATTCTAAATGGTGCCAATTTGGGAGGTGA...

Protein

Download Protein FASTA

721 aa · LXL04_027200|LXL04_027200|OH1004|PROTEIN

MEHSRWKSCMLATVGLISIFTAHFCFGDTDPRDILAINSLYAALGYPPLPGWLVSGGDPCAEGWQGVQCVNSNITGIILNGANLGGELGENLGAFFSIIQIDLSNNHIGGTIPSSLPLTIKSLMLSGNQLTGNIPDSLSMLGQMTDLSLNNNHLTGGIPDSFQQLIPLTNLDLSANNLSGPLPPSMANLSSMTTLHLQDNHLTGLLDVLQDLTLISLDVENNLFSGPIPPKLMSIPNFRSIGNPFNTTIIPSPPGISPSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027200`
TK1151 ID	TkA08G411750
OH-1004 ID	LXL04_027200
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	62.000
Protein coverage (%)	TK1151 96.176 / OH-1004 95.839 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027200

Location Chr06:10916838-10921091 (-)

Description Similar to SRF1: Protein STRUBBELIG-RECEPTOR FAMILY 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20850`	Not essential for epidermal patterning and not redundant with STRUBBELIG.	The role of the SCRAMBLED receptor-like kinase in patterning the Arabidopsis root epidermis.2007 · DOI: 10.1016/j.ydbio.2006.09.009 Molecular characterisation of the STRUBBELIG-RECEPTOR FAMILY of genes encoding putative leucine-rich repeat receptor-like kinases in Arabidopsis thaliana.2007 · DOI: 10.1186/1471-2229-7-16
`At4g03390`	Not essential for epidermal patterning and not redundant with STRUBBELIG.	The role of the SCRAMBLED receptor-like kinase in patterning the Arabidopsis root epidermis.2007 · DOI: 10.1016/j.ydbio.2006.09.009
`At1g11130`	Regulates the expression of transcription factors that define the cell fates.	No verified direct reference in this release
`At4g22130`	Protein STRUBBELIG-RECEPTOR FAMILY 8.	No verified direct reference in this release
`At1g78980`	Protein STRUBBELIG-RECEPTOR FAMILY 5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027200 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0007165 signal transduction Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0010059 positive regulation of atrichoblast fate specification Biological Process

GO:0010063 positive regulation of trichoblast fate specification Biological Process

GO:0010071 root meristem specification Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0048366 leaf development Biological Process

GO:0048367 shoot system development Biological Process

GO:0048437 floral organ development Biological Process

KEGG gene cross-reference

ath:AT1G11130

ath:AT1G78980

ath:AT2G20850

ath:AT4G03390

ath:AT4G22130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.855

Rank 1 · LXL04_027200 · OH-1004

Cytoplasm0.078

Rank 2 · LXL04_027200 · OH-1004

Endoplasmic reticulum0.077

Rank 3 · LXL04_027200 · OH-1004

Nucleus0.062

Rank 4 · LXL04_027200 · OH-1004

Lysosome / Vacuole0.025

Rank 5 · LXL04_027200 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase445-712 aa

PF07714.24PK_Tyr_Ser-Thr447-713 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027200	`PF00069.32`	Pkinase	445	712	1.7e-35	123.4
LXL04_027200	`PF07714.24`	PK_Tyr_Ser-Thr	447	713	1.9e-36	126.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q06BH3`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 1	48.594%	Swiss-Prot	moderate database homology
`Q6R2K3`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 3	47.889%	Swiss-Prot	moderate database homology
`Q8RWZ1`	Arabidopsis thaliana	Protein STRUBBELIG	44.730%	Swiss-Prot	moderate database homology
`Q6R2J8`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 8	42.047%	Swiss-Prot	moderate database homology
`Q6R2K1`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 5	40.429%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card