LXL04_026922 | RubberDandelionOmics

Gene overview

LXL04_026922

Reference: OH-1004 Chr: Chr06 Coordinates: 5393441-5395160 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1005 bp · LXL04_026922|LXL04_026922|OH1004|cDNA

ATGTCGGTACGATTGGGCCTAAATGATTTCATAGCTTGTTGTGGAAGCACTAAATTCGCGGAACAAATGGTCGCAGATGGACCTTTTGCTACTTACGACGAAGCTGTTGTTGCCGCGAGGAACATCTGGTTCAATAAGGTTGATGTTCATGGCTGGCTCGAAGCATTTGCTGCGCATCCCCAAATCGGGCAAAATCCTTCTTCAGTTGCTCACAAAAGTTCCACAAGTGCTCAGTTACATCTCCAgttctctttctttct...

CDS

Download CDS FASTA

1005 bp · LXL04_026922|LXL04_026922|OH1004|CDS

ATGTCGGTACGATTGGGCCTAAATGATTTCATAGCTTGTTGTGGAAGCACTAAATTCGCGGAACAAATGGTCGCAGATGGACCTTTTGCTACTTACGACGAAGCTGTTGTTGCCGCGAGGAACATCTGGTTCAATAAGGTTGATGTTCATGGCTGGCTCGAAGCATTTGCTGCGCATCCCCAAATCGGGCAAAATCCTTCTTCAGTTGCTCACAAAAGTTCCACAAGTGCTCAGTTACATCTCCAGTTCTCTTTCTTTCT...

Protein

Download Protein FASTA

334 aa · LXL04_026922|LXL04_026922|OH1004|PROTEIN

MSVRLGLNDFIACCGSTKFAEQMVADGPFATYDEAVVAARNIWFNKVDVHGWLEAFAAHPQIGQNPSSVAHKSSTSAQLHLQFSFFLSLWSKGEQSAALATATDSTLQELYEWNSQYKQKFGFVFLICASGRSTPEILTELKRRFSNRPIVELEIASQEQIKITELRLHKLFTNTSIQDQKSQTSDVTKAEEGRVTVLGGHITAPSIPTRSRPPITTHVLDVARGCPAGGIEVLLEMQTTNHSGPLFGQSDNAKWIFQGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026922`
TK1151 ID	TkA07G018310
OH-1004 ID	LXL04_026922
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026922

Location Chr06:5393441-5395160 (+)

Description Similar to TTL: Uric acid degradation bifunctional protein TTL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58220`	Involved in the last two steps of the degradation of uric acid, i.e. the hydrolysis of 5-hydroxyisourate (HIU) to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU) and its stereoselective decarboxylation to (S)-allantoin, a major ureide compound.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026922 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001560 regulation of cell growth by extracellular stimulus Biological Process

GO:0006144 purine nucleobase metabolic process Biological Process

GO:0006147 guanine catabolic process Biological Process

GO:0006148 inosine catabolic process Biological Process

GO:0006149 deoxyinosine catabolic process Biological Process

GO:0006154 adenosine catabolic process Biological Process

GO:0006157 deoxyadenosine catabolic process Biological Process

GO:0006161 deoxyguanosine catabolic process Biological Process

GO:0006196 AMP catabolic process Biological Process

GO:0006204 IMP catabolic process Biological Process

GO:0009114 hypoxanthine catabolic process Biological Process

GO:0009115 xanthine catabolic process Biological Process

KEGG gene cross-reference

ath:AT5G58220

cel:CELE_R09H10.3

mmu:76974

stt:t1822

sty:STY1129

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.613

Rank 1 · LXL04_026922 · OH-1004

Peroxisome0.231

Rank 2 · LXL04_026922 · OH-1004

Nucleus0.230

Rank 3 · LXL04_026922 · OH-1004

Mitochondrion0.157

Rank 4 · LXL04_026922 · OH-1004

Cell membrane0.063

Rank 5 · LXL04_026922 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09349.16OHCU_decarbox10-168 aa

PF00576.28Transthyretin215-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026922	`PF09349.16`	OHCU_decarbox	10	168	1.5e-31	110.8
LXL04_026922	`PF00576.28`	Transthyretin	215	333	2.1e-31	109.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVM5`	Arabidopsis thaliana	Uric acid degradation bifunctional protein TTL	53.982%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card