LXL04_026755 | RubberDandelionOmics

Gene overview

LXL04_026755

Reference: OH-1004 Chr: Chr06 Coordinates: 2517104-2518756 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1653 bp · LXL04_026755|LXL04_026755|OH1004|cDNA

ATGGGTGACCTCCGATTAGCAGAAGAGTGGCTTTCACGTGCTAAAGATCTTGTTCCGGTGGCTTTACAAAAGGCGCGAGAAGTTAAAGAATTTCCAGGAAGATGGAAAATGATTATATCTCGATTAGAGCAAATCCCATCTCGTTTATCAGATTTATCAAGCCACCCCTGTTTCTCGAAGAACACGTTATGCAACGAGCAATTAGAATCAATTTCCAAGACTTTAAACGAATCAATCGAGTTAGCAGAAACATGTTCGAA...

CDS

Download CDS FASTA

1653 bp · LXL04_026755|LXL04_026755|OH1004|CDS

ATGGGTGACCTCCGATTAGCAGAAGAGTGGCTTTCACGTGCTAAAGATCTTGTTCCGGTGGCTTTACAAAAGGCGCGAGAAGTTAAAGAATTTCCAGGAAGATGGAAAATGATTATATCTCGATTAGAGCAAATCCCATCTCGTTTATCAGATTTATCAAGCCACCCCTGTTTCTCGAAGAACACGTTATGCAACGAGCAATTAGAATCAATTTCCAAGACTTTAAACGAATCAATCGAGTTAGCAGAAACATGTTCGAA...

Protein

Download Protein FASTA

550 aa · LXL04_026755|LXL04_026755|OH1004|PROTEIN

MGDLRLAEEWLSRAKDLVPVALQKAREVKEFPGRWKMIISRLEQIPSRLSDLSSHPCFSKNTLCNEQLESISKTLNESIELAETCSKGKFDGKLQMQSDLDSLSGKLDLNLRDCGLLIKTGVLGEVTMGSDLEGTSHRSTENNIRELLARLQIGHLEAKHKALDTLVDVMKEDEKTVLSFVGRTNIGALVQLLTATSPRIREKTVTLICSLAESGGCESWLVSEGVLPPLIRLLESGSSIGREKSVIALQRLSMSEETAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026755`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026755

Location Chr06:2517104-2518756 (-)

Description Similar to PUB3: U-box domain-containing protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54790`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At2g23140`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g67340`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g42340`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g23030`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026755 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

GO:0048364 root development Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:1904821 chloroplast disassembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT2G23140

ath:AT3G54790

ath:AT5G42340

ath:AT5G67340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.508

Rank 1 · LXL04_026755 · OH-1004

Nucleus0.364

Rank 2 · LXL04_026755 · OH-1004

Cell membrane0.223

Rank 3 · LXL04_026755 · OH-1004

Endoplasmic reticulum0.051

Rank 4 · LXL04_026755 · OH-1004

Golgi apparatus0.041

Rank 5 · LXL04_026755 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23005.2DUF703213-122 aa

PF25598.2ARM_PUB241-517 aa

PF24768.2ARM_ARMC5252-470 aa

PF00514.30Arm422-458 aa

PF13646.13HEAT_2426-495 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026755	`PF23005.2`	DUF7032	13	122	1.8e-38	131.6
LXL04_026755	`PF25598.2`	ARM_PUB	241	517	2e-13	51.1
LXL04_026755	`PF24768.2`	ARM_ARMC5	252	470	2.1e-23	83.9
LXL04_026755	`PF00514.30`	Arm	422	458	3e-29	100.8
LXL04_026755	`PF13646.13`	HEAT_2	426	495	5.4e-10	40.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWV5`	Arabidopsis thaliana	U-box domain-containing protein 3	30.000%	Swiss-Prot	moderate database homology
`O22193`	Arabidopsis thaliana	U-box domain-containing protein 4	27.077%	Swiss-Prot	weak database homology
`Q5XEZ8`	Arabidopsis thaliana	U-box domain-containing protein 2	30.603%	Swiss-Prot	weak database homology
`Q681N2`	Arabidopsis thaliana	U-box domain-containing protein 15	27.972%	Swiss-Prot	weak database homology
`Q8GUG9`	Arabidopsis thaliana	U-box domain-containing protein 11	23.636%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card