LXL04_026655 | RubberDandelionOmics

Gene overview

LXL04_026655

Reference: OH-1004 Chr: Chr06 Coordinates: 952453-953570 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1035 bp · LXL04_026655|LXL04_026655|OH1004|cDNA

ATGGCTGAAAAACCGGAAGAAGAACAAAAACCAGAACAAGGTATGTTGCTTATATCGATTACTTTCGAATCCCATTGGCTGTCTACGGAATCAGATCGTTTAATTTCTTCTACGACAGTGTGCAACTTTTTCAGAAAACCATCAAAGAACAAAAACATCCGAAAAAGAGTTCACGATGAGGAACAAGAAGAACCGTCCGTCATAATCAACAAGAAAAAGCCCATGGCACCAGACAACAAATTACATTTCGCCACTGGATC...

CDS

Download CDS FASTA

1035 bp · LXL04_026655|LXL04_026655|OH1004|CDS

ATGGCTGAAAAACCGGAAGAAGAACAAAAACCAGAACAAGGTATGTTGCTTATATCGATTACTTTCGAATCCCATTGGCTGTCTACGGAATCAGATCGTTTAATTTCTTCTACGACAGTGTGCAACTTTTTCAGAAAACCATCAAAGAACAAAAACATCCGAAAAAGAGTTCACGATGAGGAACAAGAAGAACCGTCCGTCATAATCAACAAGAAAAAGCCCATGGCACCAGACAACAAATTACATTTCGCCACTGGATC...

Protein

Download Protein FASTA

344 aa · LXL04_026655|LXL04_026655|OH1004|PROTEIN

MAEKPEEEQKPEQGMLLISITFESHWLSTESDRLISSTTVCNFFRKPSKNKNIRKRVHDEEQEEPSVIINKKKPMAPDNKLHFATGSSKRSTTSQQQSDTKSSIFQFDSSKEIQVQNDSRATATLETETDFSRDARAIRERVLKQADEALKGKKGNDNEKLYKGIHGYTDYKAGFRREQTVASEKAGGSHGPLRASAHIRVSARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEREWDEAEKVRKRKLAMK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026655`
TK1151 ID	TkAUNG095170
OH-1004 ID	LXL04_026655
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026655

Location Chr06:952453-953570 (+)

Description Similar to At1g01350: Zinc finger CCCH domain-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01350`	Zinc finger CCCH domain-containing protein 1.	No verified direct reference in this release
`At5g06420`	Zinc finger CCCH domain-containing protein 51.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0301000`	Zinc finger CCCH domain-containing protein 15.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026655 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006281 DNA repair Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0070100 negative regulation of chemokine-mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005684 U2-type spliceosomal complex Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0071005 U2-type precatalytic spliceosome Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G01350

ath:AT5G06420

bta:493640

dosa:Os02g0301000

hsa:7737

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · LXL04_026655 · OH-1004

Cytoplasm0.186

Rank 2 · LXL04_026655 · OH-1004

Mitochondrion0.018

Rank 3 · LXL04_026655 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_026655 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_026655 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00642.31zf-CCCH207-232 aa

PF25585.2zf-CCCH_DUS3L209-237 aa

PF13920.13zf-C3HC4_3283-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026655	`PF00642.31`	zf-CCCH	207	232	6.5e-10	39.4
LXL04_026655	`PF25585.2`	zf-CCCH_DUS3L	209	237	2e-06	28.3
LXL04_026655	`PF13920.13`	zf-C3HC4_3	283	324	4.3e-08	33.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GX84`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 1	74.598%	Swiss-Prot	strong database homology
`Q9FNG6`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 51	72.669%	Swiss-Prot	strong database homology
`Q6K4V3`	Oryza sativa subsp. japonica	Zinc finger CCCH domain-containing protein 15	64.610%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card