LXL04_025993 | RubberDandelionOmics

Gene overview

LXL04_025993

Reference: OH-1004 Chr: Chr05 Coordinates: 119428881-119430023 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1065 bp · LXL04_025993|LXL04_025993|OH1004|cDNA

atgGAGAAAATACAACATAAAATGGTACCAGTGAACGACACAAACATGCACATAGCCGAGCTTGGCACAGGCCCAACCATCCTCTTCATCCATGGCTTCCCGGAGCTCTGGTACACCTGGCGCCACCAGATCCTCTACCTCGCCTCACATGGCTTCCATGCCGTGGCACCCGATCTCCGTGGCTACGGTGACACCACCGGCCCTCCTACCTCCGACCCCACCAAATTCACCACCCTTCATGTCGTTGGAGATCTGGTGGC...

CDS

Download CDS FASTA

1065 bp · LXL04_025993|LXL04_025993|OH1004|CDS

ATGGAGAAAATACAACATAAAATGGTACCAGTGAACGACACAAACATGCACATAGCCGAGCTTGGCACAGGCCCAACCATCCTCTTCATCCATGGCTTCCCGGAGCTCTGGTACACCTGGCGCCACCAGATCCTCTACCTCGCCTCACATGGCTTCCATGCCGTGGCACCCGATCTCCGTGGCTACGGTGACACCACCGGCCCTCCTACCTCCGACCCCACCAAATTCACCACCCTTCATGTCGTTGGAGATCTGGTGGC...

Protein

Download Protein FASTA

354 aa · LXL04_025993|LXL04_025993|OH1004|PROTEIN

MEKIQHKMVPVNDTNMHIAELGTGPTILFIHGFPELWYTWRHQILYLASHGFHAVAPDLRGYGDTTGPPTSDPTKFTTLHVVGDLVALINTVAAAGEEKVFVVGHDWGAMIAWALCLYRPDKVKALVNMSVPFSPRNPKFKPIDTLRALYGNDYYIIRFQEDGEIEGEFAVWGTNRVLNEFFNYRKPAPLFLPKGIGFGSSLDDPITLPPWMSKEDLEFYTSKFEKTGFTGGLNYYRALNLNWELTGPWTGAQVKVPVKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025993`
TK1151 ID	TkA06G039420
OH-1004 ID	LXL04_025993
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_025993`
Location	Chr05:119428881-119430023 (-)
Description	Similar to ephA: Epoxide hydrolase A (Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025993` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0009636 response to toxic substance Biological Process GO:0004301 epoxide hydrolase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference	mtu:Rv3617 mtv:RVBD_3617 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.742

Rank 1 · LXL04_025993 · OH-1004

Nucleus0.289

Rank 2 · LXL04_025993 · OH-1004

Peroxisome0.108

Rank 3 · LXL04_025993 · OH-1004

Mitochondrion0.071

Rank 4 · LXL04_025993 · OH-1004

Endoplasmic reticulum0.058

Rank 5 · LXL04_025993 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07224.18Chlorophyllase20-120 aa

PF00561.27Abhydrolase_125-161 aa

PF12146.16Hydrolase_426-142 aa

PF12697.14Abhydrolase_627-312 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025993	`PF07224.18`	Chlorophyllase	20	120	1.2e-08	34.8
LXL04_025993	`PF00561.27`	Abhydrolase_1	25	161	1.1e-26	94.7
LXL04_025993	`PF12146.16`	Hydrolase_4	26	142	3.1e-13	50.3
LXL04_025993	`PF12697.14`	Abhydrolase_6	27	312	2.2e-22	81.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card