RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_025855
Reference: OH-1004 Chr: Chr05 Coordinates: 117725418-117727015 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

828 bp · LXL04_025855|LXL04_025855|OH1004|cDNA

ATGGAGGTGCCAGCTAATCTCCCTTCAAGTTTTCAAATTCAAGACATCAATTCAAAAGAACCAAAGTCAGAAGTTGTTGATTACGGATGCTGTCACTACCGTAGGAAATGCAAGATAAGGTCCCCTTGTTGTAATGAAATATTTGATTGTCGCCATTGTCATAATGAAGCAAAGAATGACATCAATGTTGATCACAAAGAGAGGCACGCAATCCCTCGCCATCAAATCCAACAAGTTATATGCACCCTTTGTGGTACAGA...

CDS

Download CDS FASTA

828 bp · LXL04_025855|LXL04_025855|OH1004|CDS

ATGGAGGTGCCAGCTAATCTCCCTTCAAGTTTTCAAATTCAAGACATCAATTCAAAAGAACCAAAGTCAGAAGTTGTTGATTACGGATGCTGTCACTACCGTAGGAAATGCAAGATAAGGTCCCCTTGTTGTAATGAAATATTTGATTGTCGCCATTGTCATAATGAAGCAAAGAATGACATCAATGTTGATCACAAAGAGAGGCACGCAATCCCTCGCCATCAAATCCAACAAGTTATATGCACCCTTTGTGGTACAGA...

Protein

Download Protein FASTA

275 aa · LXL04_025855|LXL04_025855|OH1004|PROTEIN

MEVPANLPSSFQIQDINSKEPKSEVVDYGCCHYRRKCKIRSPCCNEIFDCRHCHNEAKNDINVDHKERHAIPRHQIQQVICTLCGTEQEVRQMCVNCGVCMGKYFCRTCKLFDDDISKLQFHCDGCGICRIGGRENFFHCDKCRCCYSNFLRDSHPCVEGAMHHDCPVCFEYLFDSVDDVTVMPCGHTIHKKCLKEMQQHYQYACPLCFKSVCDMSKVWEKLDMEVAATPMPEFYQNKLIRILCNDCGTNSEVGFHIVAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_025855
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_025855
LocationChr05:117725418-117727015 (+)
DescriptionSimilar to RZFP34: Probable E3 ubiquitin-protein ligase RZFP34
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g22920 Possesses E3 ubiquitin-protein ligase activity in vitro.
Expression of a gene encoding a rice RING zinc-finger protein, OsRZFP34, enhances stomata opening.2014 · DOI: 10.1007/s11103-014-0217-6
Arabidopsis RZFP34/CHYR1, a Ubiquitin E3 Ligase, Regulates Stomatal Movement and Drought Tolerance via SnRK2.6-Mediated Phosphorylation.2015 · DOI: 10.1105/tpc.15.00321
At5g18650 E3 ubiquitin-protein ligase that acts as a regulator of cell death and defense.
Arabidopsis ubiquitin ligase MIEL1 mediates degradation of the transcription factor MYB30 weakening plant defence.2013 · DOI: 10.1038/ncomms2479

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0719100 Possesses transactivation activity in yeast cells (Ref.1).
Expression of a gene encoding a rice RING zinc-finger protein, OsRZFP34, enhances stomata opening.2014 · DOI: 10.1007/s11103-014-0217-6
Os03g0348900 Possesses E3 ubiquitin-protein ligase activity in vitro.
Knock-down of stress inducible OsSRFP1 encoding an E3 ubiquitin ligase with transcriptional activation activity confers abiotic stress tolerance through enhancing antioxidant protection in rice.2015 · DOI: 10.1007/s11103-015-0294-1
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025855 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0006952 defense response Biological Process
GO:0010255 glucose mediated signaling pathway Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0031398 positive regulation of protein ubiquitination Biological Process
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process
GO:0051865 protein autoubiquitination Biological Process
GO:0072344 rescue of stalled cytosolic ribosome Biological Process
GO:1900425 negative regulation of defense response to bacterium Biological Process
GO:1902456 regulation of stomatal opening Biological Process
GO:0000151 ubiquitin ligase complex Cellular Component
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT5G18650
ath:AT5G22920
dosa:Os01g0719100
dosa:Os03g0348900
mmu:68098
osa:4324695
osa:4332833
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.586
Rank 1 · LXL04_025855 · OH-1004
Cytoplasm0.580
Rank 2 · LXL04_025855 · OH-1004
Mitochondrion0.061
Rank 3 · LXL04_025855 · OH-1004
Cell membrane0.052
Rank 4 · LXL04_025855 · OH-1004
Endoplasmic reticulum0.047
Rank 5 · LXL04_025855 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05495.18zf-CHY30-104 aa
PF13639.13zf-RING_2165-208 aa
PF14634.13zf-RING_5165-208 aa
PF13445.13zf-RING_UBOX166-206 aa
PF00097.32zf-C3HC4166-208 aa
PF13923.13zf-C3HC4_2166-208 aa
PF14599.12zinc_ribbon_6213-271 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_025855PF05495.18zf-CHY301042.4e-1763.8
LXL04_025855PF13639.13zf-RING_21652081.4e-0835.5
LXL04_025855PF14634.13zf-RING_51652081.5e-0628.7
LXL04_025855PF13445.13zf-RING_UBOX1662062.1e-0834.7
LXL04_025855PF00097.32zf-C3HC41662081.2e-0732.2
LXL04_025855PF13923.13zf-C3HC4_21662084.3e-0627.1
LXL04_025855PF14599.12zinc_ribbon_62132711.6e-2589.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FFB6Arabidopsis thalianaE3 ubiquitin-protein ligase RZFP3466.667%Swiss-Protstrong database homology
Q8VZK0Arabidopsis thalianaE3 ubiquitin-protein ligase MIEL155.422%Swiss-Protstrong database homology
Q5JL96Oryza sativa subsp. japonicaProbable E3 ubiquitin-protein ligase RZFP3470.968%Swiss-Protstrong database homology
Q10LI1Oryza sativa subsp. japonicaE3 ubiquitin-protein ligase SRFP149.388%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser