LXL04_025832 | RubberDandelionOmics

Gene overview

LXL04_025832

Reference: OH-1004 Chr: Chr05 Coordinates: 117419288-117424078 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2487 bp · LXL04_025832|LXL04_025832|OH1004|cDNA

ATGAGCCTAAAGAAACTTGTTGCACTCTTAGATCTCATTCCGAATTGTGCATCTCCACGAAAGAAGGTAGTTTCTGGATTTGGGTTAGGGTTCGTTTCGTTTTTCGTTTTCTTGTTTATGTTATTTTTTAATTTCTCTTTCATAAATCCCATTTCGAATAAACTTTTGTTCCAAGGGTTTACCATCAGTAACAACAATACTTCTCTCATCGCTTGGTCTTTTTCGTTTAGTAGTAGAACATCGTCTCTCAATTCCACTTA...

CDS

Download CDS FASTA

2487 bp · LXL04_025832|LXL04_025832|OH1004|CDS

ATGAGCCTAAAGAAACTTGTTGCACTCTTAGATCTCATTCCGAATTGTGCATCTCCACGAAAGAAGGTAGTTTCTGGATTTGGGTTAGGGTTCGTTTCGTTTTTCGTTTTCTTGTTTATGTTATTTTTTAATTTCTCTTTCATAAATCCCATTTCGAATAAACTTTTGTTCCAAGGGTTTACCATCAGTAACAACAATACTTCTCTCATCGCTTGGTCTTTTTCGTTTAGTAGTAGAACATCGTCTCTCAATTCCACTTA...

Protein

Download Protein FASTA

828 aa · LXL04_025832|LXL04_025832|OH1004|PROTEIN

MSLKKLVALLDLIPNCASPRKKVVSGFGLGFVSFFVFLFMLFFNFSFINPISNKLLFQGFTISNNNTSLIAWSFSFSSRTSSLNSTYSSSTTAIYVENGTEIAQNPKLVVTENRDESNSSNVEISLKLLGFDDKANTHFGNFTDDVKNSSFDGISEKVLEFNDTNLIKLKHDEKNETFSAIVQENANMSVKSDGLDLNLGSRNKRDEKGDGVSKKLGFAEADDGSKSQNLKVYSESLKECDIFDGRWVKDDSKPYYPAGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025832`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025832

Location Chr05:117419288-117424078 (-)

Description Similar to TBL2: Protein trichome birefringence-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60790`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g06700`	Required during cellulose deposition.	No verified direct reference in this release
`At3g12060`	Can complement TBR and is therefore functionally equivalent, but may work in different tissue.	No verified direct reference in this release
`At5g49340`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g20590`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025832 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009827 plant-type cell wall modification Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60790

ath:AT3G12060

ath:AT5G06700

ath:AT5G20590

ath:AT5G49340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.247

Rank 1 · LXL04_025832 · OH-1004

Golgi apparatus0.229

Rank 2 · LXL04_025832 · OH-1004

Cell membrane0.171

Rank 3 · LXL04_025832 · OH-1004

Nucleus0.119

Rank 4 · LXL04_025832 · OH-1004

Plastid0.084

Rank 5 · LXL04_025832 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416.12PMR5N238-291 aa

PF13839.13PC-Esterase292-558 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025832	`PF14416.12`	PMR5N	238	291	1.4e-20	74.1
LXL04_025832	`PF13839.13`	PC-Esterase	292	558	1.9e-90	304.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYR3`	Arabidopsis thaliana	Protein trichome birefringence-like 2	69.318%	Swiss-Prot	weak database homology
`Q9FG35`	Arabidopsis thaliana	Protein trichome birefringence	55.890%	Swiss-Prot	weak database homology
`Q9LHL6`	Arabidopsis thaliana	Protein trichome birefringence-like 1	54.054%	Swiss-Prot	weak database homology
`Q9FJ06`	Arabidopsis thaliana	Protein trichome birefringence-like 4	51.087%	Swiss-Prot	weak database homology
`F4K5K4`	Arabidopsis thaliana	Protein trichome birefringence-like 5	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card