LXL04_025652 | RubberDandelionOmics

Gene overview

LXL04_025652

Reference: OH-1004 Chr: Chr05 Coordinates: 114763435-114768781 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3888 bp · LXL04_025652|LXL04_025652|OH1004|cDNA

ATGAATTCTACATTCACCTCCCAAATCACCTCCCCTAACCCCTTCACGCCTTTCATCAAGACACCCTCTTTAAACTTCTGTTCATTTCCACAATCACAACATCATAGTCACCGCCGCCGGCGGTGGCGGTCTCAGACACCTTTCACTGTTATCTCCTTACATACTAACAATAAAGCCAATGTTCCCTTACAACTACCCACCAGCGCCGGCATTCATTCCACAGAGCAACGTCAGGATAAGGTACTGCTATCTAATGTAAT...

CDS

Download CDS FASTA

3888 bp · LXL04_025652|LXL04_025652|OH1004|CDS

ATGAATTCTACATTCACCTCCCAAATCACCTCCCCTAACCCCTTCACGCCTTTCATCAAGACACCCTCTTTAAACTTCTGTTCATTTCCACAATCACAACATCATAGTCACCGCCGCCGGCGGTGGCGGTCTCAGACACCTTTCACTGTTATCTCCTTACATACTAACAATAAAGCCAATGTTCCCTTACAACTACCCACCAGCGCCGGCATTCATTCCACAGAGCAACGTCAGGATAAGGTACTGCTATCTAATGTAAT...

Protein

Download Protein FASTA

1295 aa · LXL04_025652|LXL04_025652|OH1004|PROTEIN

MNSTFTSQITSPNPFTPFIKTPSLNFCSFPQSQHHSHRRRRWRSQTPFTVISLHTNNKANVPLQLPTSAGIHSTEQRQDKVLLSNVITRIAKPIAFTVFWIVIGLCPSRGFHQTHAIAAPVTSEALKSTKSKSKQEASNRKDHEFSDYTARLLETVSRLVTIIEEVRSTNGDLKTVEAALNDVKLKKTELQDEIMTRLYADLRVLRGKKMDLDRKSGDILNFMVKSKKEKDRIKEKKGEKTTKDQKLAKLDETVTKKEKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025652`
TK1151 ID	TkA06G047330
OH-1004 ID	LXL04_025652
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025652

Location Chr05:114763435-114768781 (-)

Description Similar to FTSHI5: Probable inactive ATP-dependent zinc metalloprotease FTSHI 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04340`	Required for plastid development during embryogenesis.	FtsHi4 is essential for embryogenesis due to its influence on chloroplast development in Arabidopsis.2014 · DOI: 10.1371/journal.pone.0099741

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025652 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010304 PSII associated light-harvesting complex II catabolic process Biological Process

GO:0019684 photosynthesis, light reaction Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0051301 cell division Biological Process

GO:0080093 regulation of photorespiration Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G04340

pml:ATP_00273

sfu:Sfum_3197

syn:slr1604

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.922

Rank 1 · LXL04_025652 · OH-1004

Mitochondrion0.065

Rank 2 · LXL04_025652 · OH-1004

Nucleus0.040

Rank 3 · LXL04_025652 · OH-1004

Cytoplasm0.027

Rank 4 · LXL04_025652 · OH-1004

Cell membrane0.022

Rank 5 · LXL04_025652 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13191.13AAA_16782-833 aa

PF00004.36AAA794-927 aa

PF01434.25Peptidase_M411076-1250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025652	`PF13191.13`	AAA_16	782	833	4.9e-06	27.9
LXL04_025652	`PF00004.36`	AAA	794	927	2.6e-31	109.5
LXL04_025652	`PF01434.25`	Peptidase_M41	1076	1250	5.1e-12	46.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J3N2`	Arabidopsis thaliana	Probable inactive ATP-dependent zinc metalloprotease FTSHI 5, chloroplastic	61.388%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card