LXL04_025619 | RubberDandelionOmics

Gene overview

LXL04_025619

Reference: OH-1004 Chr: Chr05 Coordinates: 114369642-114377071 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5529 bp · LXL04_025619|LXL04_025619|OH1004|cDNA

ATGATGAATTACAATATTGTTCTGTGTGTTGAAATTTATAACAGGCGACAGAGAAAATGTCATCCAATGGGCACTGTTTTAGAAGAAAACCACGCCAACCAGTTGCTGCTAATTTGGATGTTGACTCACTGGTATCTTgatgaaaatttagaacaatGGCCACATCTAAATGAACTTGTTCAATGCTACAAGACTGATTGGATTAAAGATGAAAACAAGTATGGGCACTATGAAAGTGTTGGAAGTATATCCTTTCAGAA...

CDS

Download CDS FASTA

5529 bp · LXL04_025619|LXL04_025619|OH1004|CDS

ATGATGAATTACAATATTGTTCTGTGTGTTGAAATTTATAACAGGCGACAGAGAAAATGTCATCCAATGGGCACTGTTTTAGAAGAAAACCACGCCAACCAGTTGCTGCTAATTTGGATGTTGACTCACTGGTATCTTGATGAAAATTTAGAACAATGGCCACATCTAAATGAACTTGTTCAATGCTACAAGACTGATTGGATTAAAGATGAAAACAAGTATGGGCACTATGAAAGTGTTGGAAGTATATCCTTTCAGAA...

Protein

Download Protein FASTA

1842 aa · LXL04_025619|LXL04_025619|OH1004|PROTEIN

MMNYNIVLCVEIYNRRQRKCHPMGTVLEENHANQLLLIWMLTHWYLDENLEQWPHLNELVQCYKTDWIKDENKYGHYESVGSISFQNQIFEGPDTDIETEMHLANARHDKIEDITDDDVPSTSGRQLTEHYGESPLPAYEPVFDWENERSMIFGQRIPESNMPQSSSGLKISVKVLSLSFQAGLVEPFYGTISLYNKERREKLSEDFIFRVLPSEMQDASSSSESRGLFYLDAPSSSICLLIQLEKCATEEGGVTPSVYS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025619`
TK1151 ID	TkA06G048590
OH-1004 ID	LXL04_025619
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 98.628 / OH-1004 97.557 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025619

Location Chr05:114369642-114377071 (-)

Description Similar to SPK1: Guanine nucleotide exchange factor SPIKE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16340`	Guanine nucleotide exchange factor (GEF) for Rho and Rac.	SPIKE1 signals originate from and assemble specialized domains of the endoplasmic reticulum.2010 · DOI: 10.1016/j.cub.2010.11.016 A ROP GTPase-dependent auxin signaling pathway regulates the subcellular distribution of PIN2 in Arabidopsis roots.2012 · DOI: 10.1016/j.cub.2012.05.019

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025619 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007264 small GTPase-mediated signal transduction Biological Process

GO:0008064 regulation of actin polymerization or depolymerization Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0035023 regulation of Rho protein signal transduction Biological Process

GO:0043547 positive regulation of GTPase activity Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0048446 petal morphogenesis Biological Process

GO:0051211 anisotropic cell growth Biological Process

KEGG gene cross-reference

ath:AT4G16340

mmu:76088

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.610

Rank 1 · LXL04_025619 · OH-1004

Golgi apparatus0.205

Rank 2 · LXL04_025619 · OH-1004

Nucleus0.187

Rank 3 · LXL04_025619 · OH-1004

Cell membrane0.145

Rank 4 · LXL04_025619 · OH-1004

Lysosome / Vacuole0.126

Rank 5 · LXL04_025619 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14429.13DOCK-C2470-637 aa

PF28208.1TPR_DOCK9667-897 aa

PF06920.20DHR-2_Lobe_A1387-1540 aa

PF20422.4DHR-2_Lobe_B1608-1690 aa

PF20421.5DHR-2_Lobe_C1740-1834 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025619	`PF14429.13`	DOCK-C2	470	637	4.2e-33	115.6
LXL04_025619	`PF28208.1`	TPR_DOCK9	667	897	2.9e-62	211.2
LXL04_025619	`PF06920.20`	DHR-2_Lobe_A	1387	1540	1.7e-36	126.6
LXL04_025619	`PF20422.4`	DHR-2_Lobe_B	1608	1690	1.2e-21	77.3
LXL04_025619	`PF20421.5`	DHR-2_Lobe_C	1740	1834	1.7e-27	96.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8SAB7`	Arabidopsis thaliana	Guanine nucleotide exchange factor SPIKE 1	79.008%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card