LXL04_025097 | RubberDandelionOmics

Gene overview

LXL04_025097

Reference: OH-1004 Chr: Chr05 Coordinates: 105931438-105932046 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

609 bp · LXL04_025097|LXL04_025097|OH1004|cDNA

ATGGGTTTGAAGAATTTGTTTAATCGGAAGAAGAAAAGCGGCAAGGACGACAGCAGCCACAACGGCACAAATCCGGTGACGCAGAAGTCTCCGGTTGCATCGCGTACGAGCTCCTTCAACTCTCGCGAGCGGATCGAAGAGGAGTTGGAGCAAGTGTTCAAGAAGTTCGACGTCAATGGGGATGGGAAGATCTCGTGGTCTGAGTTGGGATCGATAATGGGCAGCCTCGGCCACCAGCCTAACGAGGAGGAACTAAAGAA...

CDS

Download CDS FASTA

609 bp · LXL04_025097|LXL04_025097|OH1004|CDS

ATGGGTTTGAAGAATTTGTTTAATCGGAAGAAGAAAAGCGGCAAGGACGACAGCAGCCACAACGGCACAAATCCGGTGACGCAGAAGTCTCCGGTTGCATCGCGTACGAGCTCCTTCAACTCTCGCGAGCGGATCGAAGAGGAGTTGGAGCAAGTGTTCAAGAAGTTCGACGTCAATGGGGATGGGAAGATCTCGTGGTCTGAGTTGGGATCGATAATGGGCAGCCTCGGCCACCAGCCTAACGAGGAGGAACTAAAGAA...

Protein

Download Protein FASTA

202 aa · LXL04_025097|LXL04_025097|OH1004|PROTEIN

MGLKNLFNRKKKSGKDDSSHNGTNPVTQKSPVASRTSSFNSRERIEEELEQVFKKFDVNGDGKISWSELGSIMGSLGHQPNEEELKNMIKEVDADGDGFINLQEFVELNTKDIDSAEVLENLKDAFSVFDIDKNGSISAEELHNVLESLGEDCSIAECQKMIAGVDVNGDGMISFDEFKVMMMTGTRFDSIGSKRHVEVKDN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025097`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025097

Location Chr05:105931438-105932046 (-)

Description Similar to CML25: Probable calcium-binding protein CML25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24620`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0949500`	Potential calcium sensor.	No verified direct reference in this release
`Os05g0380900`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025097 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048767 root hair elongation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G24620

dosa:Os01g0949500

dosa:Os05g0380900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.359

Rank 1 · LXL04_025097 · OH-1004

Cytoplasm0.319

Rank 2 · LXL04_025097 · OH-1004

Nucleus0.203

Rank 3 · LXL04_025097 · OH-1004

Endoplasmic reticulum0.106

Rank 4 · LXL04_025097 · OH-1004

Lysosome / Vacuole0.086

Rank 5 · LXL04_025097 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10591.16SPARC_Ca_bdg35-106 aa

PF21008.4AIF-139-108 aa

PF13499.13EF-hand_746-108 aa

PF00036.39EF-hand_148-75 aa

PF13405.13EF-hand_648-77 aa

PF13202.13EF-hand_549-73 aa

PF14658.13EF-hand_951-106 aa

PF30551.1CFAP251_C61-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025097	`PF10591.16`	SPARC_Ca_bdg	35	106	5.3e-10	40.3
LXL04_025097	`PF21008.4`	AIF-1	39	108	7.9e-15	56.1
LXL04_025097	`PF13499.13`	EF-hand_7	46	108	1.2e-31	109.6
LXL04_025097	`PF00036.39`	EF-hand_1	48	75	9.6e-35	116.3
LXL04_025097	`PF13405.13`	EF-hand_6	48	77	6.1e-28	94.5
LXL04_025097	`PF13202.13`	EF-hand_5	49	73	2e-27	94.1
LXL04_025097	`PF14658.13`	EF-hand_9	51	106	4.8e-13	50.1
LXL04_025097	`PF30551.1`	CFAP251_C	61	163	2.2e-09	37.9
LXL04_025097	`PF13833.13`	EF-hand_8	71	108	4.8e-21	75.0
LXL04_025097	`PF00036.39`	EF-hand_1	84	108	9.6e-35	116.3
LXL04_025097	`PF13202.13`	EF-hand_5	89	107	2e-27	94.1
LXL04_025097	`PF21008.4`	AIF-1	114	187	7.9e-15	56.1
LXL04_025097	`PF13499.13`	EF-hand_7	120	182	1.2e-31	109.6
LXL04_025097	`PF00036.39`	EF-hand_1	122	148	9.6e-35	116.3
LXL04_025097	`PF13405.13`	EF-hand_6	122	150	6.1e-28	94.5
LXL04_025097	`PF13202.13`	EF-hand_5	122	145	2e-27	94.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYK2`	Arabidopsis thaliana	Probable calcium-binding protein CML25	59.677%	Swiss-Prot	strong database homology
`Q8RZB5`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML10	49.474%	Swiss-Prot	moderate database homology
`Q6L4D4`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML15	47.651%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card