LXL04_024322 | RubberDandelionOmics

Gene overview

LXL04_024322

Reference: OH-1004 Chr: Chr05 Coordinates: 87377827-87379789 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · LXL04_024322|LXL04_024322|OH1004|cDNA

ATGATGAACGTGCAAGAGACCTTACTTCAAGTGGTGTTGATGTGTACACAACTCTTGCTGGAGCAGTTGGACTGGTTAAGTAATATGGCGTATTGGTGTTTTGAATGTGCCACTTCTAAATGCTATCTTTGGATTCTCAGGTTAAGCAATATTGGAGAAGTGGGTTACAGTCCAGCAATACAGTTGGACAACTTTAAAAGTGGGAGATTTTATACTATGATAACTTCTGCTTTCAGTCATATTGAAGTTGGCCATATTGT...

CDS

Download CDS FASTA

456 bp · LXL04_024322|LXL04_024322|OH1004|CDS

ATGATGAACGTGCAAGAGACCTTACTTCAAGTGGTGTTGATGTGTACACAACTCTTGCTGGAGCAGTTGGACTGGTTAAGTAATATGGCGTATTGGTGTTTTGAATGTGCCACTTCTAAATGCTATCTTTGGATTCTCAGGTTAAGCAATATTGGAGAAGTGGGTTACAGTCCAGCAATACAGTTGGACAACTTTAAAAGTGGGAGATTTTATACTATGATAACTTCTGCTTTCAGTCATATTGAAGTTGGCCATATTGT...

Protein

Download Protein FASTA

151 aa · LXL04_024322|LXL04_024322|OH1004|PROTEIN

MMNVQETLLQVVLMCTQLLLEQLDWLSNMAYWCFECATSKCYLWILRLSNIGEVGYSPAIQLDNFKSGRFYTMITSAFSHIEVGHIVYDMIGLYLFCKSIGNFFGPAFLLKFYLAGALVCSPYFLVHHAFLAPSSKANERFEDIMCALIKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024322`
TK1151 ID	TkA07G413350
OH-1004 ID	LXL04_024322
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.900
Protein coverage (%)	TK1151 25.305 / OH-1004 54.967 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024322

Location Chr05:87377827-87379789 (+)

Description Similar to RBL12: RHOMBOID-like protein 12, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18600`	Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis.	Plant mitochondrial rhomboid, AtRBL12, has different substrate specificity from its yeast counterpart.2008 · DOI: 10.1007/s11103-008-9359-8
`At1g74130`	Rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release
`At1g74140`	Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024322 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010821 regulation of mitochondrion organization Biological Process

GO:0016485 protein processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18600

ath:AT1G74130

ath:AT1G74140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.310

Rank 1 · LXL04_024322 · OH-1004

Endoplasmic reticulum0.182

Rank 2 · LXL04_024322 · OH-1004

Peroxisome0.140

Rank 3 · LXL04_024322 · OH-1004

Cytoplasm0.101

Rank 4 · LXL04_024322 · OH-1004

Nucleus0.056

Rank 5 · LXL04_024322 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01694.29Rhomboid68-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024322	`PF01694.29`	Rhomboid	68	128	2.5e-08	34.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ81`	Arabidopsis thaliana	RHOMBOID-like protein 12, mitochondrial	62.500%	Swiss-Prot	moderate database homology
`Q84WG3`	Arabidopsis thaliana	Rhomboid-like protein 16, chloroplastic	46.053%	Swiss-Prot	moderate database homology
`B3H707`	Arabidopsis thaliana	Rhomboid-like protein 17, chloroplastic	49.275%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card