Gene Card
Gene overview
cDNA / CDS / Protein Sequences
390 bp · LXL04_023820|LXL04_023820|OH1004|cDNA
ATGGCCTTCTTTCAGGTTCGAATTCCGGAACAGTTGATGGCGGCTTTCCCGATTCGGTTTAAAGAGGATTCAGATCTGGTTATCGCGAACGCCTTCTTTCAGGAGCTCGTGGACATCGGAAGTTCATTGAAGTGTGCTAGAGCACCGGCGTGCTACTGGTCACCGATTCCACCGGCAGAGTTGAGAGGAGAATCTACTCGTCTCATTTGCTTTAATCAGTTAGATCTTCCTGAATACTCAACAAAAGAACAACTTCAAGA...
390 bp · LXL04_023820|LXL04_023820|OH1004|CDS
ATGGCCTTCTTTCAGGTTCGAATTCCGGAACAGTTGATGGCGGCTTTCCCGATTCGGTTTAAAGAGGATTCAGATCTGGTTATCGCGAACGCCTTCTTTCAGGAGCTCGTGGACATCGGAAGTTCATTGAAGTGTGCTAGAGCACCGGCGTGCTACTGGTCACCGATTCCACCGGCAGAGTTGAGAGGAGAATCTACTCGTCTCATTTGCTTTAATCAGTTAGATCTTCCTGAATACTCAACAAAAGAACAACTTCAAGA...
Protein
Download Protein FASTA129 aa · LXL04_023820|LXL04_023820|OH1004|PROTEIN
MAFFQVRIPEQLMAAFPIRFKEDSDLVIANAFFQELVDIGSSLKCARAPACYWSPIPPAELRGESTRLICFNQLDLPEYSTKEQLQELIACNFFKTLISYVDVTASTNRADIFDPALMRRKIEFPHQQI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_023820 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_023820 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:69844636-69845960 (+) | |||||||||
| Description | Similar to ARPC2B: Actin-related protein 2/3 complex subunit 2B | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0007015 actin filament organization Biological Process GO:0010090 trichome morphogenesis Biological Process GO:0030041 actin filament polymerization Biological Process GO:0034314 Arp2/3 complex-mediated actin nucleation Biological Process GO:0005737 cytoplasm Cellular Component GO:0005885 Arp2/3 protein complex Cellular Component GO:0042995 cell projection Cellular Component GO:0005200 structural constituent of cytoskeleton Molecular Function GO:0051015 actin filament binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G30825 ath:AT2G33385 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.