LXL04_023125 | RubberDandelionOmics

Gene overview

LXL04_023125

Reference: OH-1004 Chr: Chr05 Coordinates: 23903743-23904341 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

294 bp · LXL04_023125|LXL04_023125|OH1004|cDNA

ATGGCAGCTGTTGGAGGAATTACCGAATGCAAAGGCACCGAAAATAGCCTTGAGATCGACAACCTTGCTAAATTTGCCGTTGATGAACACAACAAGAAACAGAATGCACTATTGGAATTTGGGAAGGTAGTAAATGCAAAGGAACAGGTAGTACAAGGTAAGATGTATTATATCACAATTGAGGTAAAGGAGGGTGGAGAGAATAAAACTTATGAAGCCAAGGTGTGGGTTAAGCCATGGGAGGACTTCAAGGAATTGCA...

CDS

Download CDS FASTA

294 bp · LXL04_023125|LXL04_023125|OH1004|CDS

ATGGCAGCTGTTGGAGGAATTACCGAATGCAAAGGCACCGAAAATAGCCTTGAGATCGACAACCTTGCTAAATTTGCCGTTGATGAACACAACAAGAAACAGAATGCACTATTGGAATTTGGGAAGGTAGTAAATGCAAAGGAACAGGTAGTACAAGGTAAGATGTATTATATCACAATTGAGGTAAAGGAGGGTGGAGAGAATAAAACTTATGAAGCCAAGGTGTGGGTTAAGCCATGGGAGGACTTCAAGGAATTGCA...

Protein

Download Protein FASTA

97 aa · LXL04_023125|LXL04_023125|OH1004|PROTEIN

MAAVGGITECKGTENSLEIDNLAKFAVDEHNKKQNALLEFGKVVNAKEQVVQGKMYYITIEVKEGGENKTYEAKVWVKPWEDFKELQEFKAVDAATS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023125`
TK1151 ID	TkA07G081110
OH-1004 ID	LXL04_023125
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	55.400
Protein coverage (%)	TK1151 40.444 / OH-1004 94.845 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023125

Location Chr05:23903743-23904341 (+)

Description Similar to Cysteine proteinase inhibitor A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12490`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release
`At2g40880`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0803200`	There are two distinct cystatins in rice seeds (Oryzacystatin-1 and -2) with different specificities against cysteine proteinases.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023125 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004869 cysteine-type endopeptidase inhibitor activity Molecular Function

GO:0050897 cobalt ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G40880

ath:AT3G12490

dosa:Os01g0803200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.765

Rank 1 · LXL04_023125 · OH-1004

Nucleus0.250

Rank 2 · LXL04_023125 · OH-1004

Extracellular0.127

Rank 3 · LXL04_023125 · OH-1004

Mitochondrion0.097

Rank 4 · LXL04_023125 · OH-1004

Endoplasmic reticulum0.068

Rank 5 · LXL04_023125 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00031.28Cystatin5-92 aa

PF16845.12SQAPI18-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023125	`PF00031.28`	Cystatin	5	92	6.6e-21	75.1
LXL04_023125	`PF16845.12`	SQAPI	18	92	4.9e-24	85.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0X6`	Arabidopsis thaliana	Cysteine proteinase inhibitor 6	59.794%	Swiss-Prot	strong database homology
`Q41906`	Arabidopsis thaliana	Cysteine proteinase inhibitor 3	59.770%	Swiss-Prot	strong database homology
`P09229`	Oryza sativa subsp. japonica	Cysteine proteinase inhibitor 1	63.830%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card