LXL04_022575 | RubberDandelionOmics

Gene overview

LXL04_022575

Reference: OH-1004 Chr: Chr05 Coordinates: 1730301-1732737 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1599 bp · LXL04_022575|LXL04_022575|OH1004|cDNA

ATGAAGAACAACAGCAATAACAATATGGTGGCGGATAAGACACGGGCCCTGCCGGTTGACCCGAATCTCCCACGGTGGGTCTGCCAGAATTGCCGTCACAGTCTCTCCATCACCGGCGTTGATGCTTACCCTGATAAATTCTTCAATGACTCCTCCAGTTACCGATCCGGGATGCAGGGCTCTTCGATGCATGGGGCAAGCAGTGTGTTAGGCACACGAATGGATCAATCGTTTGTTGTATTACCAAAACAAAGGAACCA...

CDS

Download CDS FASTA

1599 bp · LXL04_022575|LXL04_022575|OH1004|CDS

ATGAAGAACAACAGCAATAACAATATGGTGGCGGATAAGACACGGGCCCTGCCGGTTGACCCGAATCTCCCACGGTGGGTCTGCCAGAATTGCCGTCACAGTCTCTCCATCACCGGCGTTGATGCTTACCCTGATAAATTCTTCAATGACTCCTCCAGTTACCGATCCGGGATGCAGGGCTCTTCGATGCATGGGGCAAGCAGTGTGTTAGGCACACGAATGGATCAATCGTTTGTTGTATTACCAAAACAAAGGAACCA...

Protein

Download Protein FASTA

532 aa · LXL04_022575|LXL04_022575|OH1004|PROTEIN

MKNNSNNNMVADKTRALPVDPNLPRWVCQNCRHSLSITGVDAYPDKFFNDSSSYRSGMQGSSMHGASSVLGTRMDQSFVVLPKQRNQSSGVPPRPRNGSMNPDSTHSGKAMEESFVVLPPPAASVYKSDPTLDGGGTHFQSHEGGSNSAPTQSNNSGFHSTITVLKRAFEIATTQTQVEQPLCLECMRVLSDKLDKEVEDVNSDIKSYEACLQRLEGEPRNVLSEADFLREKLKIEDEERKLEAAIQETEKQCAEVTGEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022575`
TK1151 ID	TkA06G475470
OH-1004 ID	LXL04_022575
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022575

Location Chr05:1730301-1732737 (+)

Description Similar to ATG6: Beclin-1-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61710`	Required for normal plant development.	An Arabidopsis homolog of yeast ATG6/VPS30 is essential for pollen germination.2007 · DOI: 10.1104/pp.106.093864 Arabidopsis AtBECLIN 1/AtAtg6/AtVps30 is essential for pollen germination and plant development.2007 · DOI: 10.1038/cr.2007.7 Arabidopsis ATG6 is required to limit the pathogen-associated cell death response.2008 · DOI: 10.4161/auto.5056 Autophagy protein 6 (ATG6) is required for pollen germination in Arabidopsis thaliana.2008 · DOI: 10.4161/auto.5629

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022575 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000423 mitophagy Biological Process

GO:0006623 protein targeting to vacuole Biological Process

GO:0006914 autophagy Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0009846 pollen germination Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0032465 regulation of cytokinesis Biological Process

GO:0045022 early endosome to late endosome transport Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT3G61710

ddi:DDB_G0288021

dre:393846

xla:444178

xtr:619357

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.615

Rank 1 · LXL04_022575 · OH-1004

Golgi apparatus0.231

Rank 2 · LXL04_022575 · OH-1004

Lysosome / Vacuole0.188

Rank 3 · LXL04_022575 · OH-1004

Nucleus0.181

Rank 4 · LXL04_022575 · OH-1004

Cell membrane0.142

Rank 5 · LXL04_022575 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17675.7APG6_N181-309 aa

PF04111.18APG6312-487 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022575	`PF17675.7`	APG6_N	181	309	2.7e-27	96.5
LXL04_022575	`PF04111.18`	APG6	312	487	4.5e-60	203.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M367`	Arabidopsis thaliana	Beclin-1-like protein	73.398%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card