LXL04_022508 | RubberDandelionOmics

Gene overview

LXL04_022508

Reference: OH-1004 Chr: Chr04 Coordinates: 151783617-151785908 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1467 bp · LXL04_022508|LXL04_022508|OH1004|cDNA

ATGACGACGGCGAGCAGTTTCGGTTCCGGTTCCGGGTCCGGGTCGTTGAGTTCAAAACCTGCACCGGGTGTGCCAGATCAGTTCCCTGTGGGTTTGAGAGTTCTCGTTGTTGATGACGATGTAACTTGCTTGAAGATTTTGGAGCGCTTGCTTCGCAGATGCTCTTATCATGTTACAACTTGCTCACAGGCAACCACTGCCTTAAATATGCTAAGAGAAAGAAAAGACGGTTTTGATGTGGTATTAAGTGATGTACATAT...

CDS

Download CDS FASTA

1467 bp · LXL04_022508|LXL04_022508|OH1004|CDS

ATGACGACGGCGAGCAGTTTCGGTTCCGGTTCCGGGTCCGGGTCGTTGAGTTCAAAACCTGCACCGGGTGTGCCAGATCAGTTCCCTGTGGGTTTGAGAGTTCTCGTTGTTGATGACGATGTAACTTGCTTGAAGATTTTGGAGCGCTTGCTTCGCAGATGCTCTTATCATGTTACAACTTGCTCACAGGCAACCACTGCCTTAAATATGCTAAGAGAAAGAAAAGACGGTTTTGATGTGGTATTAAGTGATGTACATAT...

Protein

Download Protein FASTA

488 aa · LXL04_022508|LXL04_022508|OH1004|PROTEIN

MTTASSFGSGSGSGSLSSKPAPGVPDQFPVGLRVLVVDDDVTCLKILERLLRRCSYHVTTCSQATTALNMLRERKDGFDVVLSDVHMPDMDGFKLLELVGLEMDLPVIMMSADGRTNLVLRGIRHGACDYLIKPIREEQLKNIWQHVIRKKWNENKEHEHSGSVEHKRGGDDNNNNNHDNEYGTCSVNEGENGAVMTCHKKRRNVKEEDDCELESDDPSASKKPRVVWSVELHQQFVSAVNQLGIDKAVPKRILELMNVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022508`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022508

Location Chr04:151783617-151785908 (+)

Description Similar to RR21: Two-component response regulator ORR21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16110`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	The response regulator ARR2: a pollen-specific transcription factor involved in the expression of nuclear genes for components of mitochondrial complex I in Arabidopsis.2001 · DOI: 10.1007/s004380000400 Two-component circuitry in Arabidopsis cytokinin signal transduction.2001 · DOI: 10.1038/35096500 The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis.2004 · DOI: 10.1038/sj.emboj.7600337 Cytokinin-mediated control of leaf longevity by AHK3 through phosphorylation of ARR2 in Arabidopsis.2006 · DOI: 10.1073/pnas.0505150103
`At3g16857`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	Two-component circuitry in Arabidopsis cytokinin signal transduction.2001 · DOI: 10.1038/35096500 ARR1, a transcription factor for genes immediately responsive to cytokinins.2001 · DOI: 10.1126/science.1065201 A genetic framework for the control of cell division and differentiation in the root meristem.2008 · DOI: 10.1126/science.1164147
`At2g01760`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XE31`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`Os03g0224200`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022508 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010380 regulation of chlorophyll biosynthetic process Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

KEGG gene cross-reference

ath:AT2G01760

ath:AT3G16857

ath:AT4G16110

dosa:Os03g0224200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · LXL04_022508 · OH-1004

Cytoplasm0.077

Rank 2 · LXL04_022508 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_022508 · OH-1004

Endoplasmic reticulum0.016

Rank 4 · LXL04_022508 · OH-1004

Plastid0.011

Rank 5 · LXL04_022508 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00072.31Response_reg34-142 aa

PF00249.38Myb_DNA-binding225-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022508	`PF00072.31`	Response_reg	34	142	2.7e-24	86.2
LXL04_022508	`PF00249.38`	Myb_DNA-binding	225	274	3.8e-08	34.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZWJ9`	Arabidopsis thaliana	Two-component response regulator ARR2	55.014%	Swiss-Prot	strong database homology
`Q940D0`	Arabidopsis thaliana	Two-component response regulator ARR1	57.751%	Swiss-Prot	moderate database homology
`Q8L9Y3`	Arabidopsis thaliana	Two-component response regulator ARR14	59.006%	Swiss-Prot	moderate database homology
`A2XE31`	Oryza sativa subsp. indica	Two-component response regulator ORR21	55.530%	Swiss-Prot	strong database homology
`Q8H7S7`	Oryza sativa subsp. japonica	Two-component response regulator ORR21	55.530%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card