LXL04_022444 | RubberDandelionOmics

Gene overview

LXL04_022444

Reference: OH-1004 Chr: Chr04 Coordinates: 150406948-150409706 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1923 bp · LXL04_022444|LXL04_022444|OH1004|cDNA

ATGGTTGGTGGTACCCATCAACAACCGCAAGCTTCTCAATTGGATCCGCCTCCTTCGTCATCGTCGACTGTTCTGGCAGCTCCGACGGAGGAAGAGGAGTTTTTGAAAAGAAACACCGATTGCGTTTACTTCCTTGCATCTCCGCTAACCTGCAAAAAGGGAATTGAATGCGAGTATCGCCATAGTGACATTGCACGTGTCAACCCTAGAGATTGCTGGTATTGGTTAAATGGAAACTGCTTAAATCCAAAATGTGGCTT...

CDS

Download CDS FASTA

1923 bp · LXL04_022444|LXL04_022444|OH1004|CDS

ATGGTTGGTGGTACCCATCAACAACCGCAAGCTTCTCAATTGGATCCGCCTCCTTCGTCATCGTCGACTGTTCTGGCAGCTCCGACGGAGGAAGAGGAGTTTTTGAAAAGAAACACCGATTGCGTTTACTTCCTTGCATCTCCGCTAACCTGCAAAAAGGGAATTGAATGCGAGTATCGCCATAGTGACATTGCACGTGTCAACCCTAGAGATTGCTGGTATTGGTTAAATGGAAACTGCTTAAATCCAAAATGTGGCTT...

Protein

Download Protein FASTA

640 aa · LXL04_022444|LXL04_022444|OH1004|PROTEIN

MVGGTHQQPQASQLDPPPSSSSTVLAAPTEEEEFLKRNTDCVYFLASPLTCKKGIECEYRHSDIARVNPRDCWYWLNGNCLNPKCGFRHPPLDGLLEAEVPPPVGPTLPQTPVTPSPHGTPYPMSKQGVPCIFFQKGFCLKGHLCPFLHGPPNIVNNKPTPPVPSNNITKVAPEKPIQEQKLVQQETVKKPVDFQPPKVKQVPTPARNGGGSGGDGGGRMEKKVEEPRYRPANAIPPPVTNEFPVNRSNHGNVYEDETTH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022444`
TK1151 ID	TkA03G560880
OH-1004 ID	LXL04_022444
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	48.600
Protein coverage (%)	TK1151 88.976 / OH-1004 90.781 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022444

Location Chr04:150406948-150409706 (+)

Description Similar to At2g02160: Zinc finger CCCH domain-containing protein 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02160`	Zinc finger CCCH domain-containing protein 17.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0831100`	Zinc finger CCCH domain-containing protein 19.	No verified direct reference in this release
`Os04g0671800`	Zinc finger CCCH domain-containing protein 32.	No verified direct reference in this release
`Os05g0176400`	Zinc finger CCCH domain-containing protein 34.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022444 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G02160

dosa:Os02g0831100

dosa:Os04g0671800

dosa:Os05g0176400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · LXL04_022444 · OH-1004

Cytoplasm0.145

Rank 2 · LXL04_022444 · OH-1004

Cell membrane0.016

Rank 3 · LXL04_022444 · OH-1004

Mitochondrion0.011

Rank 4 · LXL04_022444 · OH-1004

Endoplasmic reticulum0.007

Rank 5 · LXL04_022444 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15663.12zf-CCCH_336-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022444	`PF15663.12`	zf-CCCH_3	36	91	2.6e-14	54.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUM0`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 17	38.019%	Swiss-Prot	moderate database homology
`Q6K977`	Oryza sativa subsp. japonica	Zinc finger CCCH domain-containing protein 19	34.233%	Swiss-Prot	moderate database homology
`Q0J952`	Oryza sativa subsp. japonica	Zinc finger CCCH domain-containing protein 32	31.050%	Swiss-Prot	moderate database homology
`Q6AT25`	Oryza sativa subsp. japonica	Zinc finger CCCH domain-containing protein 34	32.288%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card