LXL04_021916 | RubberDandelionOmics

Gene overview

LXL04_021916

Reference: OH-1004 Chr: Chr04 Coordinates: 140178619-140180575 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

924 bp · LXL04_021916|LXL04_021916|OH1004|cDNA

ATGCTCTACATGGCCGCTAATTGGGGGAATAATTCTAAAAGTCGCATCATCTTCAATGCCATCTGTCACGGTTTGTTGTGGAATCTTTGGAAGGCTAGGAATGATAGAATTTTCAGAAAACAGTTTAAATCCCCCACTCTAGTGTTCGATGAAGTTGTTTCCATGGTGTTTTTGTGGCTAAAATGGGGACGGGAGATTGGGTCAAGTGTAATCCTGTGCAGTCATGTACGGATTATCTATTCATATGATTTCTCTCCCAC...

CDS

Download CDS FASTA

924 bp · LXL04_021916|LXL04_021916|OH1004|CDS

ATGCTCTACATGGCCGCTAATTGGGGGAATAATTCTAAAAGTCGCATCATCTTCAATGCCATCTGTCACGGTTTGTTGTGGAATCTTTGGAAGGCTAGGAATGATAGAATTTTCAGAAAACAGTTTAAATCCCCCACTCTAGTGTTCGATGAAGTTGTTTCCATGGTGTTTTTGTGGCTAAAATGGGGACGGGAGATTGGGTCAAGTGTAATCCTGTGCAGTCATGTACGGATTATCTATTCATATGATTTCTCTCCCAC...

Protein

Download Protein FASTA

307 aa · LXL04_021916|LXL04_021916|OH1004|PROTEIN

MLYMAANWGNNSKSRIIFNAICHGLLWNLWKARNDRIFRKQFKSPTLVFDEVVSMVFLWLKWGREIGSSVILCSHVRIIYSYDFSPTNLTMAVLNFTFCWSKLHSLPISKPSSITLQIPSSPQVQTQYKITHDSSINLSESISKACITALVSASLFFAADPALAFKGGGPYGSEVTRGQDLSGKDFSGRTLIKQDFKTSILRQANFKGAKLLGASFFDSDLTGADLTDADLRGADFSLANVTKANLTNANLEGALVTGNT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021916`
TK1151 ID	TkA05G434580
OH-1004 ID	LXL04_021916
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 70.684 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021916

Location Chr04:140178619-140180575 (-)

Description Similar to At2g44920: Thylakoid lumenal 15 kDa protein 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44920`	Thylakoid lumenal 15 kDa protein 1, chloroplastic.	No verified direct reference in this release
`At1g12250`	Pentapeptide repeat protein of unknown function.	No verified direct reference in this release
`At5g55000`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021916 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

KEGG gene cross-reference

ath:AT1G12250

ath:AT2G44920

ath:AT5G55000

cyt:cce_1272

syn:slr1819

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.980

Rank 1 · LXL04_021916 · OH-1004

Mitochondrion0.023

Rank 2 · LXL04_021916 · OH-1004

Nucleus0.013

Rank 3 · LXL04_021916 · OH-1004

Cell membrane0.011

Rank 4 · LXL04_021916 · OH-1004

Cytoplasm0.010

Rank 5 · LXL04_021916 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13599.14Pentapeptide_4196-271 aa

PF00805.29Pentapeptide199-237 aa

PF13576.13Pentapeptide_3201-237 aa

PF00805.29Pentapeptide219-257 aa

PF00805.29Pentapeptide234-274 aa

PF13576.13Pentapeptide_3243-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021916	`PF13599.14`	Pentapeptide_4	196	271	3.3e-08	34.2
LXL04_021916	`PF00805.29`	Pentapeptide	199	237	2.1e-22	79.0
LXL04_021916	`PF13576.13`	Pentapeptide_3	201	237	6.4e-11	43.0
LXL04_021916	`PF00805.29`	Pentapeptide	219	257	2.1e-22	79.0
LXL04_021916	`PF00805.29`	Pentapeptide	234	274	2.1e-22	79.0
LXL04_021916	`PF13576.13`	Pentapeptide_3	243	275	6.4e-11	43.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22160`	Arabidopsis thaliana	Thylakoid lumenal 15 kDa protein 1, chloroplastic	83.529%	Swiss-Prot	moderate database homology
`Q8H1Q1`	Arabidopsis thaliana	Thylakoid lumenal protein TL20.3, chloroplastic	35.669%	Swiss-Prot	weak database homology
`Q9SE95`	Arabidopsis thaliana	FH protein interacting protein FIP2	37.838%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card