LXL04_021489 | RubberDandelionOmics

Gene overview

LXL04_021489

Reference: OH-1004 Chr: Chr04 Coordinates: 131109968-131112474 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1503 bp · LXL04_021489|LXL04_021489|OH1004|cDNA

ATGGATCTGAATAAACGGGGATTTGTTGTTTTAGTTATTGGGTTTGTTGTTCTTCTTGAATTATGTTTGTTGGCATCAGGCAATGTGGTTTTCCAGGTTCAGCATAAGTTTGCTGGTAACAAAAGGTCCTTGACTCAATTTAAAGCTCATGATTCCGACCGTCATCGGAGGATTCTCTCAGCCGTTGACCTTCCCATTGGCGGCGACGGCAGCCCCACTTCAGCAGCGCTCTATTTCACTAAAATTCAAATTGGAACTCC...

CDS

Download CDS FASTA

1503 bp · LXL04_021489|LXL04_021489|OH1004|CDS

ATGGATCTGAATAAACGGGGATTTGTTGTTTTAGTTATTGGGTTTGTTGTTCTTCTTGAATTATGTTTGTTGGCATCAGGCAATGTGGTTTTCCAGGTTCAGCATAAGTTTGCTGGTAACAAAAGGTCCTTGACTCAATTTAAAGCTCATGATTCCGACCGTCATCGGAGGATTCTCTCAGCCGTTGACCTTCCCATTGGCGGCGACGGCAGCCCCACTTCAGCAGCGCTCTATTTCACTAAAATTCAAATTGGAACTCC...

Protein

Download Protein FASTA

500 aa · LXL04_021489|LXL04_021489|OH1004|PROTEIN

MDLNKRGFVVLVIGFVVLLELCLLASGNVVFQVQHKFAGNKRSLTQFKAHDSDRHRRILSAVDLPIGGDGSPTSAALYFTKIQIGTPPKDYHVQVDTGSDLLWVNCAGCQKCPKKSDLGISLALYNPQASSTAKMVNCDQDICITTLSDPNIDCKAGMYCSYQVTYGDGSSTMGYFVKDVIRLDKASGNLQTTFMNGSIAFGQVSSFLLISIYRCGSQQSGELGSSEQALDGILGFGQANSSMLSQLAASKRVKKVFSHC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021489`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021489

Location Chr04:131109968-131112474 (+)

Description Similar to At1g65240: Aspartic proteinase-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65240`	Displays aspartic proteolytic activity.	No verified direct reference in this release
`At5g36260`	Displays aspartic proteolytic activity.	No verified direct reference in this release
`At1g49050`	Involved in proteolytic processing of BAG6 and plant basal immunity.	Aspartyl Protease-Mediated Cleavage of BAG6 Is Necessary for Autophagy and Fungal Resistance in Plants.2016 · DOI: 10.1105/tpc.15.00626
`At3g12700`	Aspartic proteinase that can use azocasein as substrate and regulates endogenous sugar levels (e.g. sucrose, glucose and fructose) by modulating starch accumulation and remobilization.	Misexpression of a chloroplast aspartyl protease leads to severe growth defects and alters carbohydrate metabolism in Arabidopsis.2012 · DOI: 10.1104/pp.112.204016

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0184800`	Aspartic proteinase Asp1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021489 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006508 proteolysis Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009555 pollen development Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010019 chloroplast-nucleus signaling pathway Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G49050

ath:AT1G65240

ath:AT3G12700

ath:AT5G36260

dosa:Os11g0184800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.450

Rank 1 · LXL04_021489 · OH-1004

Lysosome / Vacuole0.186

Rank 2 · LXL04_021489 · OH-1004

Extracellular0.169

Rank 3 · LXL04_021489 · OH-1004

Cytoplasm0.146

Rank 4 · LXL04_021489 · OH-1004

Endoplasmic reticulum0.102

Rank 5 · LXL04_021489 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543.12TAXi_N78-273 aa

PF00026.29Asp78-139 aa

PF00026.29Asp161-441 aa

PF14541.12TAXi_C290-442 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021489	`PF14543.12`	TAXi_N	78	273	6.8e-36	124.8
LXL04_021489	`PF00026.29`	Asp	78	139	1.1e-27	98.0
LXL04_021489	`PF00026.29`	Asp	161	441	1.1e-27	98.0
LXL04_021489	`PF14541.12`	TAXi_C	290	442	2.8e-23	83.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9K4`	Arabidopsis thaliana	Aspartic proteinase 39	49.260%	Swiss-Prot	moderate database homology
`Q4V3D2`	Arabidopsis thaliana	Aspartic proteinase 36	49.045%	Swiss-Prot	moderate database homology
`Q9M9A8`	Arabidopsis thaliana	Aspartyl protease APCB1	27.536%	Swiss-Prot	weak database homology
`Q9LTW4`	Arabidopsis thaliana	Aspartic proteinase NANA, chloroplast	26.636%	Swiss-Prot	weak database homology
`Q0IU52`	Oryza sativa subsp. japonica	Aspartic proteinase Asp1	28.710%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card