LXL04_020587 | RubberDandelionOmics

Gene overview

LXL04_020587

Reference: OH-1004 Chr: Chr04 Coordinates: 93085864-93088986 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

915 bp · LXL04_020587|LXL04_020587|OH1004|cDNA

ATGAGTGTGGGGTTGGGGTTGGGATTGGGATTGGGGATTTGGGGGAATGGGTATGATGGTAGGTTTGGGTTGTGGATGGATGGGGTAAATGGATCAAGaactaccaccggccaccagACCATCGACGACTACTACCGCTGCACACCACTAGACCGCCGCCACTGGAGTTTGTTGAAGATTCGTTCGGAAGAATATCAGTTCCGACACTTAGGGCGGGATTGGAAACTAGAAGAGGGAAACCAAAATATTTCAATCTTCAT...

CDS

Download CDS FASTA

915 bp · LXL04_020587|LXL04_020587|OH1004|CDS

ATGAGTGTGGGGTTGGGGTTGGGATTGGGATTGGGGATTTGGGGGAATGGGTATGATGGTAGGTTTGGGTTGTGGATGGATGGGGTAAATGGATCAAGAACTACCACCGGCCACCAGACCATCGACGACTACTACCGCTGCACACCACTAGACCGCCGCCACTGGAGTTTGTTGAAGATTCGTTCGGAAGAATATCAGTTCCGACACTTAGGGCGGGATTGGAAACTAGAAGAGGGAAACCAAAATATTTCAATCTTCAT...

Protein

Download Protein FASTA

304 aa · LXL04_020587|LXL04_020587|OH1004|PROTEIN

MSVGLGLGLGLGIWGNGYDGRFGLWMDGVNGSRTTTGHQTIDDYYRCTPLDRRHWSLLKIRSEEYQFRHLGRDWKLEEGNQNISIFIFALTRKPQPRTQHRTLNTRSLPLSNSQRLSGDNTGSTAAAATPTGHLLAAPTSPPLTSHPPTSAQVLLDARRICLAPPPRLQNGYMLFKNLPWMFYHKVIGVGTFFLFVEGKAASPSVSKVLESIPGVRVIYRTKELEEKQATSRIWNETWLSSFFYRPCNYELFVKQSLNMK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020587`
TK1151 ID	TkA02G044450
OH-1004 ID	LXL04_020587
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.900
Protein coverage (%)	TK1151 35.652 / OH-1004 13.816 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020587

Location Chr04:93085864-93088986 (+)

Description Similar to ELD1: Glycosyltransferase-like KOBITO 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08550`	Involved in the coordination between cell elongation and cellulose synthesis by promoting the expression of genes involved in cell elongation and cellulose synthesis.	The role of the Arabidopsis ELD1 gene in cell development and photomorphogenesis in darkness.2000 · DOI: 10.1104/pp.123.2.509 KOBITO1 encodes a novel plasma membrane protein necessary for normal synthesis of cellulose during cell expansion in Arabidopsis.2002 · DOI: 10.1105/tpc.002873 The Arabidopsis thaliana ABSCISIC ACID-INSENSITIVE8 encodes a novel protein mediating abscisic acid and sugar responses essential for growth.2004 · DOI: 10.1105/tpc.018077 The elongation defective1 mutant of Arabidopsis is impaired in the gene encoding a serine-rich secreted protein.2003 · DOI: 10.1023/b:plan.0000019067.05185.d6 Regulation of plasmodesmatal permeability and stomatal patterning by the glycosyltransferase-like protein KOBITO1.2012 · DOI: 10.1104/pp.112.194563 Glycosyltransferase-like protein ABI8/ELD1/KOB1 promotes Arabidopsis hypocotyl elongation through regulating cellulose biosynthesis.2015 · DOI: 10.1111/pce.12395
`At3g57200`	Involved in the coordination between cell elongation and cellulose synthesis by promoting the expression of genes involved in cell elongation and cellulose synthesis.	No verified direct reference in this release
`At2g41451`	Involved in the coordination between cell elongation and cellulose synthesis by promoting the expression of genes involved in cell elongation and cellulose synthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020587 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009663 plasmodesma organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009749 response to glucose Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0030154 cell differentiation Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0051301 cell division Biological Process

KEGG gene cross-reference

ath:AT2G41451

ath:AT3G08550

ath:AT3G57200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.364

Rank 1 · LXL04_020587 · OH-1004

Cytoplasm0.294

Rank 2 · LXL04_020587 · OH-1004

Mitochondrion0.157

Rank 3 · LXL04_020587 · OH-1004

Endoplasmic reticulum0.123

Rank 4 · LXL04_020587 · OH-1004

Cell membrane0.109

Rank 5 · LXL04_020587 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9Z9`	Arabidopsis thaliana	Glycosyltransferase-like KOBITO 1	65.217%	Swiss-Prot	weak database homology
`Q5XV99`	Arabidopsis thaliana	Glycosyltransferase-like At3g57200	55.556%	Swiss-Prot	weak database homology
`B3H5R0`	Arabidopsis thaliana	Glycosyltransferase-like At2g41451	53.889%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card