RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_019065
Reference: OH-1004 Chr: Chr04 Coordinates: 23017119-23026242 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3840 bp · LXL04_019065|LXL04_019065|OH1004|cDNA

ATGGTGCCCATCGAGCACAACAAGATCGGCCTTTCCCTTCTAATACTCTTCTGCATTTTAACCCAAGATTATTGTGCACATTCCATTCCATTAGAAAACCAAAATATCAACGTAAATAACAATATTGCACTAGATATTGGATTCATTGTAGATATGGAGTCATGGGTAGGGAAGTCCATTCACCAGTGCATTACCATGGCGATATCTAACTTTTATGCTCTTAATCCAAGTTACAAAACAAGGATAGTTGTACACACTAG...

CDS

Download CDS FASTA

3840 bp · LXL04_019065|LXL04_019065|OH1004|CDS

ATGGTGCCCATCGAGCACAACAAGATCGGCCTTTCCCTTCTAATACTCTTCTGCATTTTAACCCAAGATTATTGTGCACATTCCATTCCATTAGAAAACCAAAATATCAACGTAAATAACAATATTGCACTAGATATTGGATTCATTGTAGATATGGAGTCATGGGTAGGGAAGTCCATTCACCAGTGCATTACCATGGCGATATCTAACTTTTATGCTCTTAATCCAAGTTACAAAACAAGGATAGTTGTACACACTAG...

Protein

Download Protein FASTA

1279 aa · LXL04_019065|LXL04_019065|OH1004|PROTEIN

MVPIEHNKIGLSLLILFCILTQDYCAHSIPLENQNINVNNNIALDIGFIVDMESWVGKSIHQCITMAISNFYALNPSYKTRIVVHTRDSKGDLVKVLSAVDDLLKNVKVQAIIGPEIFLQSKLLSMFADKAKVPIFSFSSRSSKEFPYLFQIKSEESTMAKSIAALVESYKWRNVIFIHEDTDDGREILPYLVESFQENNIQISYISAISSSATLDEITDELTKLINYETTIIIVHMSPSLASNLLLNAKRLGMVTEEYA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_019065
TK1151 IDTkA05G015890
OH-1004 IDLXL04_019065
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)92.300
Protein coverage (%)TK1151 95.663 / OH-1004 27.052
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_019065
LocationChr04:23017119-23026242 (-)
DescriptionSimilar to GLR1.3: Glutamate receptor 1.3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g48410 Glutamate-gated receptor that probably acts as a non-selective cation channel. No verified direct reference in this release
At5g48400 Glutamate-gated receptor that probably acts as a non-selective cation channel. No verified direct reference in this release
At3g07520 Glutamate-gated receptor that probably acts as a non-selective cation channel.
Arabidopsis thaliana glutamate receptor ion channel function demonstrated by ion pore transplantation.2008 · DOI: 10.1016/j.jmb.2008.06.076
At2g29120 Glutamate-gated receptor that probably acts as a non-selective cation channel. No verified direct reference in this release
At2g29110 Glutamate-gated receptor that probably acts as a non-selective cation channel. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_019065 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006816 calcium ion transport Biological Process
GO:0006874 intracellular calcium ion homeostasis Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0019722 calcium-mediated signaling Biological Process
GO:0030003 intracellular monoatomic cation homeostasis Biological Process
GO:0071230 cellular response to amino acid stimulus Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0005261 monoatomic cation channel activity Molecular Function
GO:0005262 calcium channel activity Molecular Function
GO:0008066 glutamate receptor activity Molecular Function
GO:0015276 ligand-gated monoatomic ion channel activity Molecular Function
GO:0038023 signaling receptor activity Molecular Function
KEGG gene cross-reference
ath:AT3G07520
ath:AT5G48400
ath:AT5G48410
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.663
Rank 1 · LXL04_019065 · OH-1004
Extracellular0.095
Rank 2 · LXL04_019065 · OH-1004
Cytoplasm0.088
Rank 3 · LXL04_019065 · OH-1004
Endoplasmic reticulum0.085
Rank 4 · LXL04_019065 · OH-1004
Lysosome / Vacuole0.050
Rank 5 · LXL04_019065 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13458.13Peripla_BP_646-368 aa
PF01094.35ANF_receptor62-385 aa
PF10613.15Lig_chan-Glu_bd446-545 aa
PF00497.26SBP_bac_3465-741 aa
PF00060.33Lig_chan583-771 aa
PF13458.13Peripla_BP_6808-1114 aa
PF01094.35ANF_receptor817-1125 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_019065PF13458.13Peripla_BP_6463684.9e-2383.0
LXL04_019065PF01094.35ANF_receptor623852.3e-120402.6
LXL04_019065PF10613.15Lig_chan-Glu_bd4465451.3e-0732.4
LXL04_019065PF00497.26SBP_bac_34657411.5e-1454.6
LXL04_019065PF00060.33Lig_chan5837715.5e-1143.2
LXL04_019065PF13458.13Peripla_BP_680811144.9e-2383.0
LXL04_019065PF01094.35ANF_receptor81711252.3e-120402.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FH75Arabidopsis thalianaGlutamate receptor 1.335.088%Swiss-Protmoderate database homology
Q9LV72Arabidopsis thalianaGlutamate receptor 1.235.088%Swiss-Protmoderate database homology
Q8LGN1Arabidopsis thalianaGlutamate receptor 1.436.454%Swiss-Protmoderate database homology
Q8LGN0Arabidopsis thalianaGlutamate receptor 2.734.601%Swiss-Protmoderate database homology
Q9C5V5Arabidopsis thalianaGlutamate receptor 2.835.810%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser