LXL04_018963 | RubberDandelionOmics

Gene overview

LXL04_018963

Reference: OH-1004 Chr: Chr04 Coordinates: 20456148-20458890 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1254 bp · LXL04_018963|LXL04_018963|OH1004|cDNA

ATGAGAATTGTTGGAAGGGTTTTGTGCAGAAACTTGGTTCGGGCTTTCTCAGGTCGCAGCTTAGGAGATGGAAGCAATCATCTGCGGTCCAAGACCCATTCTTTCTCTACTCCCCCGTACTCCACTGTGGCTGAGCTGCAACCTCAATCATCCGCGGAACTGATCAAGATTATGGAGCACAGGCTGTCGGCTATTGAGCACCGGAGTGTTTATCTTCAGGGCATTATAAACCAGCCAGAAGCCTCATCAACTGAGTATTC...

CDS

Download CDS FASTA

1254 bp · LXL04_018963|LXL04_018963|OH1004|CDS

ATGAGAATTGTTGGAAGGGTTTTGTGCAGAAACTTGGTTCGGGCTTTCTCAGGTCGCAGCTTAGGAGATGGAAGCAATCATCTGCGGTCCAAGACCCATTCTTTCTCTACTCCCCCGTACTCCACTGTGGCTGAGCTGCAACCTCAATCATCCGCGGAACTGATCAAGATTATGGAGCACAGGCTGTCGGCTATTGAGCACCGGAGTGTTTATCTTCAGGGCATTATAAACCAGCCAGAAGCCTCATCAACTGAGTATTC...

Protein

Download Protein FASTA

417 aa · LXL04_018963|LXL04_018963|OH1004|PROTEIN

MRIVGRVLCRNLVRAFSGRSLGDGSNHLRSKTHSFSTPPYSTVAELQPQSSAELIKIMEHRLSAIEHRSVYLQGIINQPEASSTEYSRANKELQNLNVKMDLISKLRTIQKEIESLKSLASDCEKDKDMQEMAYEELEVALKEEKNVHTLLLKALLPKDDADERGCILEVRAGTGGEEASLFAMDTFKMYERYSQKKGWRFEVVDVTDSNMKGYKEATAAISGVDVYGKLKFESGVHRVQRVPVTEKCGRVHTSAVSVAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018963`
TK1151 ID	TkA05G005530
OH-1004 ID	LXL04_018963
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018963

Location Chr04:20456148-20458890 (+)

Description Similar to prfA: Peptide chain release factor 1 (Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47020`	Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA in mitochondria.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018963 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016149 translation release factor activity, codon specific Molecular Function

KEGG gene cross-reference

ath:AT2G47020

rbo:A1I_06315

rru:Rru_A0750

swi:Swit_2530

zmo:ZMO1509

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.692

Rank 1 · LXL04_018963 · OH-1004

Plastid0.199

Rank 2 · LXL04_018963 · OH-1004

Cytoplasm0.083

Rank 3 · LXL04_018963 · OH-1004

Nucleus0.080

Rank 4 · LXL04_018963 · OH-1004

Peroxisome0.014

Rank 5 · LXL04_018963 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03462.24PCRF72-258 aa

PF00472.27RF-1265-375 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018963	`PF03462.24`	PCRF	72	258	2e-59	201.4
LXL04_018963	`PF00472.27`	RF-1	265	375	2.6e-39	134.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVR7`	Arabidopsis thaliana	Peptide chain release factor 1, mitochondrial	69.639%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card