LXL04_018519 | RubberDandelionOmics

Gene overview

LXL04_018519

Reference: OH-1004 Chr: Chr04 Coordinates: 14123100-14127045 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2172 bp · LXL04_018519|LXL04_018519|OH1004|cDNA

ATGATGGCTCAATCTTCGTATAGAGTTCGATCGGTTGGTGATTACGTTGTCGGCAAACAGCTTGGGTCGGGTTCGTTTTCCGTGGTGTGGCACGCGAGGCATAAGGTCCATGGGACGGAAGTTGCTATCAAGGAAATTCTCACCGGAAAATTGAACAAAAAATTGGAAGAGAGTCTCATGTCGGAGATTGACATCTTGAGTAATATTAACCACCCTAATATTATTCGACTGCACGACATGATCAAGGAGCCTGGAAAGAT...

CDS

Download CDS FASTA

2172 bp · LXL04_018519|LXL04_018519|OH1004|CDS

ATGATGGCTCAATCTTCGTATAGAGTTCGATCGGTTGGTGATTACGTTGTCGGCAAACAGCTTGGGTCGGGTTCGTTTTCCGTGGTGTGGCACGCGAGGCATAAGGTCCATGGGACGGAAGTTGCTATCAAGGAAATTCTCACCGGAAAATTGAACAAAAAATTGGAAGAGAGTCTCATGTCGGAGATTGACATCTTGAGTAATATTAACCACCCTAATATTATTCGACTGCACGACATGATCAAGGAGCCTGGAAAGAT...

Protein

Download Protein FASTA

723 aa · LXL04_018519|LXL04_018519|OH1004|PROTEIN

MMAQSSYRVRSVGDYVVGKQLGSGSFSVVWHARHKVHGTEVAIKEILTGKLNKKLEESLMSEIDILSNINHPNIIRLHDMIKEPGKIHLVLEYCKGGDLSMFIQRRQGRIPKSTSLHLMQQLAAGLKVLRDNQIIHRDLKPQNLLLSSNEDNSTLKIADFGFARSLQPRGLAETLCGSPLYMAPEIMQLHKYDAKVLHSADLWSVGAILFQLVTGRTPFTGNNQIQLLQNIMKSTELQFPPDVKDLSPECIDLCRKLLRQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018519`
TK1151 ID	TkA08G066110
OH-1004 ID	LXL04_018519
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018519

Location Chr04:14123100-14127045 (+)

Description Similar to ATG1C: Serine/threonine-protein kinase ATG1c

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37840`	Serine/threonine protein kinase involved in autophagy.	No verified direct reference in this release
`At3g53930`	Serine/threonine protein kinase involved in autophagy.	No verified direct reference in this release
`At3g61960`	Serine/threonine protein kinase involved in autophagy in a nutritional condition-dependent manner.	The ATG1/ATG13 protein kinase complex is both a regulator and a target of autophagic recycling in Arabidopsis.2011 · DOI: 10.1105/tpc.111.090993
`At1g49180`	Serine/threonine protein kinase involved in autophagy.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018519 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0006914 autophagy Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0009847 spore germination Biological Process

GO:0010506 regulation of autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

GO:0048102 autophagic cell death Biological Process

GO:0051365 cellular response to potassium ion starvation Biological Process

GO:0061709 reticulophagy Biological Process

GO:0075016 appressorium formation Biological Process

KEGG gene cross-reference

ath:AT1G49180

ath:AT2G37840

ath:AT3G53930

ath:AT3G61960

mgr:MGG_06393

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.692

Rank 1 · LXL04_018519 · OH-1004

Nucleus0.281

Rank 2 · LXL04_018519 · OH-1004

Cell membrane0.099

Rank 3 · LXL04_018519 · OH-1004

Golgi apparatus0.081

Rank 4 · LXL04_018519 · OH-1004

Lysosome / Vacuole0.072

Rank 5 · LXL04_018519 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase15-277 aa

PF07714.24PK_Tyr_Ser-Thr17-271 aa

PF24497.2MIT_ATG1490-617 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018519	`PF00069.32`	Pkinase	15	277	3.8e-70	237.0
LXL04_018519	`PF07714.24`	PK_Tyr_Ser-Thr	17	271	9.3e-46	156.9
LXL04_018519	`PF24497.2`	MIT_ATG1	490	617	1.5e-45	155.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IRW0`	Arabidopsis thaliana	Serine/threonine-protein kinase ATG1c	58.960%	Swiss-Prot	strong database homology
`F4JBP3`	Arabidopsis thaliana	Serine/threonine-protein kinase ATG1b	56.908%	Swiss-Prot	strong database homology
`Q94C95`	Arabidopsis thaliana	Serine/threonine-protein kinase ATG1a	39.372%	Swiss-Prot	moderate database homology
`F4I1N8`	Arabidopsis thaliana	Serine/threonine-protein kinase ATG1t	45.725%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card