LXL04_018264 | RubberDandelionOmics

Gene overview

LXL04_018264

Reference: OH-1004 Chr: Chr04 Coordinates: 10050151-10054763 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2112 bp · LXL04_018264|LXL04_018264|OH1004|cDNA

ATGGAGGACAGAAAAGCCAACATCATCGCTGTTTCTTCAGTCATCTTCCTCATCGGTGTCATCATCGTCGCCCGAGTAGTTCTAGATCTAAAAAGATCATTTTTCCTAATCGTCGGCGCCGCCGTTGCTGCTATTCTGCCAATCATTGCTTTCTACTTCATCCGGCGGCATCTCAGCCACAGACGTACGATGATGGAGACTAGACTTGCATCGGAAGGAAAAGAGCTCCGAATCGAGTACAGCTTTCTCCGGAAAGTCGC...

CDS

Download CDS FASTA

2112 bp · LXL04_018264|LXL04_018264|OH1004|CDS

ATGGAGGACAGAAAAGCCAACATCATCGCTGTTTCTTCAGTCATCTTCCTCATCGGTGTCATCATCGTCGCCCGAGTAGTTCTAGATCTAAAAAGATCATTTTTCCTAATCGTCGGCGCCGCCGTTGCTGCTATTCTGCCAATCATTGCTTTCTACTTCATCCGGCGGCATCTCAGCCACAGACGTACGATGATGGAGACTAGACTTGCATCGGAAGGAAAAGAGCTCCGAATCGAGTACAGCTTTCTCCGGAAAGTCGC...

Protein

Download Protein FASTA

703 aa · LXL04_018264|LXL04_018264|OH1004|PROTEIN

MEDRKANIIAVSSVIFLIGVIIVARVVLDLKRSFFLIVGAAVAAILPIIAFYFIRRHLSHRRTMMETRLASEGKELRIEYSFLRKVAGLPTKFRYKELEEITDNWKSLIGRGASASVFKGITKDGTAVAVKRIQHEEERGEKEFRSEIAAIASVQHVNLVRLFGYCIHNNLRFLVYEFIPNGSLANWIFSRPRLTARGCESSGGCLSWGLRSAVALDVAKALAYLHHDCRSRVLHLDVKPENILLDENHRAIVSDFGLSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018264`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018264

Location Chr04:10050151-10054763 (+)

Description Similar to At5g20050: Probable receptor-like protein kinase At5g20050

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20050`	Probable receptor-like protein kinase At5g20050.	No verified direct reference in this release
`At4g32300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5.	No verified direct reference in this release
`At5g24080`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080.	No verified direct reference in this release
`At1g34300`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300.	No verified direct reference in this release
`At5g35370`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018264 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0031625 ubiquitin protein ligase binding Molecular Function

KEGG gene cross-reference

ath:AT1G34300

ath:AT4G32300

ath:AT5G20050

ath:AT5G24080

ath:AT5G35370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.551

Rank 1 · LXL04_018264 · OH-1004

Cytoplasm0.227

Rank 2 · LXL04_018264 · OH-1004

Nucleus0.209

Rank 3 · LXL04_018264 · OH-1004

Endoplasmic reticulum0.080

Rank 4 · LXL04_018264 · OH-1004

Plastid0.045

Rank 5 · LXL04_018264 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase106-390 aa

PF07714.24PK_Tyr_Ser-Thr106-389 aa

PF02230.23Abhydrolase_2473-694 aa

PF12697.14Abhydrolase_6485-594 aa

PF03959.20FSH1530-652 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018264	`PF00069.32`	Pkinase	106	390	2.6e-44	152.3
LXL04_018264	`PF07714.24`	PK_Tyr_Ser-Thr	106	389	7.1e-37	127.8
LXL04_018264	`PF02230.23`	Abhydrolase_2	473	694	5.4e-40	138.3
LXL04_018264	`PF12697.14`	Abhydrolase_6	485	594	8.6e-06	27.2
LXL04_018264	`PF03959.20`	FSH1	530	652	2e-07	31.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94C25`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g20050	60.442%	Swiss-Prot	moderate database homology
`Q8RWZ5`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5	44.350%	Swiss-Prot	moderate database homology
`Q9FLV4`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080	40.000%	Swiss-Prot	moderate database homology
`Q9XID3`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300	42.470%	Swiss-Prot	weak database homology
`O65238`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370	39.943%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card