LXL04_018198 | RubberDandelionOmics

Gene overview

LXL04_018198

Reference: OH-1004 Chr: Chr04 Coordinates: 8544305-8546715 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1755 bp · LXL04_018198|LXL04_018198|OH1004|cDNA

ATGAAACTTCAAAATCTCACATTAAAAACAACAATGTCGTCGAATTCAGACCATCAGATTCATCAAGACCGTTCATTTGTGTCTAATCATGAACATCAATCAACGTCTGTGATGGTTCCACCGCCGTGCTCTCATTTGGCGGAGTTCAAGGCCGGACGAGGGGCTGCGGCGTTTGGTAAGTTACTGGAACGCATTCAAGTGAGTCCGCTCGGACGCGCCTCTGTGCGAAGGAAACCTAATGAGATCTTCCGGTGCGGCGC...

CDS

Download CDS FASTA

1755 bp · LXL04_018198|LXL04_018198|OH1004|CDS

ATGAAACTTCAAAATCTCACATTAAAAACAACAATGTCGTCGAATTCAGACCATCAGATTCATCAAGACCGTTCATTTGTGTCTAATCATGAACATCAATCAACGTCTGTGATGGTTCCACCGCCGTGCTCTCATTTGGCGGAGTTCAAGGCCGGACGAGGGGCTGCGGCGTTTGGTAAGTTACTGGAACGCATTCAAGTGAGTCCGCTCGGACGCGCCTCTGTGCGAAGGAAACCTAATGAGATCTTCCGGTGCGGCGC...

Protein

Download Protein FASTA

584 aa · LXL04_018198|LXL04_018198|OH1004|PROTEIN

MKLQNLTLKTTMSSNSDHQIHQDRSFVSNHEHQSTSVMVPPPCSHLAEFKAGRGAAAFGKLLERIQVSPLGRASVRRKPNEIFRCGACRQSSPRLYACVSCPAVVCDIHAPDHEHEIAIDVDRAELFCHSCGDQIYDRDFDSAIVLSQTAAATLGGCNSLYAPPPENLRKRRRVDYRPWTPDPKERALLGTNSSFSPGNNEGAPSNSNFPVGLKGLNNLGSTCFMNSVLQALLHTPPLRNYFLSDRHNRFLCQQKNGAYH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018198`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018198

Location Chr04:8544305-8546715 (+)

Description Similar to UBP22: Ubiquitin C-terminal hydrolase 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10790`	Component of a deubiquitination module (DUB module) that specifically deubiquitinates monoubiquitinated histone H2B (H2Bub).	The Adaptor Protein ENY2 Is a Component of the Deubiquitination Module of the Arabidopsis SAGA Transcriptional Co-activator Complex but not of the TREX-2 Complex.2018 · DOI: 10.1016/j.jmb.2018.03.018 DET1-mediated degradation of a SAGA-like deubiquitination module controls H2Bub homeostasis.2018 · DOI: 10.7554/elife.37892

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018198 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000086 G2/M transition of mitotic cell cycle Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006508 proteolysis Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0032481 positive regulation of type I interferon production Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045931 positive regulation of mitotic cell cycle Biological Process

KEGG gene cross-reference

ath:AT5G10790

bta:509694

hsa:23326

mmu:216825

xla:444339

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.792

Rank 1 · LXL04_018198 · OH-1004

Cytoplasm0.217

Rank 2 · LXL04_018198 · OH-1004

Cell membrane0.043

Rank 3 · LXL04_018198 · OH-1004

Mitochondrion0.029

Rank 4 · LXL04_018198 · OH-1004

Endoplasmic reticulum0.026

Rank 5 · LXL04_018198 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00443.36UCH215-570 aa

PF13423.13UCH_1215-550 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018198	`PF00443.36`	UCH	215	570	4.9e-56	190.9
LXL04_018198	`PF13423.13`	UCH_1	215	550	1.2e-17	65.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LEW0`	Arabidopsis thaliana	Ubiquitin C-terminal hydrolase 22	44.991%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card