LXL04_017892 | RubberDandelionOmics

Gene overview

LXL04_017892

Reference: OH-1004 Chr: Chr04 Coordinates: 2943325-2944244 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · LXL04_017892|LXL04_017892|OH1004|cDNA

ATGAGACGGCGACCAGGAATCGGTGGTTTACAAACTGCCGCCGCTGCTAGGGATCAATATCGATTATTGGGAGAAAATGTAGCCAAGTTAAGAACCGATATTATGAAAGAACAGATTTCTAATTTTCATTCTCAGTTAGAAGACTTCGCTCGCAAACACAAGACACGATCGCTACTCAAGACGCTTGGTGATCGTCCCGATCATGAAGCTGTCGACGCTGCTAAGGCGAGGCTTGCGGAGATTGACTCGATGTTTTCGAA...

CDS

Download CDS FASTA

522 bp · LXL04_017892|LXL04_017892|OH1004|CDS

ATGAGACGGCGACCAGGAATCGGTGGTTTACAAACTGCCGCCGCTGCTAGGGATCAATATCGATTATTGGGAGAAAATGTAGCCAAGTTAAGAACCGATATTATGAAAGAACAGATTTCTAATTTTCATTCTCAGTTAGAAGACTTCGCTCGCAAACACAAGACACGATCGCTACTCAAGACGCTTGGTGATCGTCCCGATCATGAAGCTGTCGACGCTGCTAAGGCGAGGCTTGCGGAGATTGACTCGATGTTTTCGAA...

Protein

Download Protein FASTA

173 aa · LXL04_017892|LXL04_017892|OH1004|PROTEIN

MRRRPGIGGLQTAAAARDQYRLLGENVAKLRTDIMKEQISNFHSQLEDFARKHKTRSLLKTLGDRPDHEAVDAAKARLAEIDSMFSNDLYEIKLSDKVDLEEEIKKKAIERERQMHKTLISLDQMHQSYDKMLCEAEKRLEKLYESVNAGKQPLQDINRMIKRWFTLTYHPIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017892`
TK1151 ID	TkA08G042980
OH-1004 ID	LXL04_017892
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017892

Location Chr04:2943325-2944244 (-)

Description Similar to VP22-1: Vacuolar protein sorting-associated protein 22 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27040`	Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release
`At5g05850`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	PIRL1 and PIRL9, encoding members of a novel plant-specific family of leucine-rich repeat proteins, are essential for differentiation of microspores into pollen.2010 · DOI: 10.1007/s00425-010-1242-6 Effect of sporophytic PIRL9 genotype on post-meiotic expression of the Arabidopsis pirl1;pirl9 mutant pollen phenotype.2011 · DOI: 10.1007/s00425-010-1324-5
`At3g11330`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	PIRL1 and PIRL9, encoding members of a novel plant-specific family of leucine-rich repeat proteins, are essential for differentiation of microspores into pollen.2010 · DOI: 10.1007/s00425-010-1242-6 Effect of sporophytic PIRL9 genotype on post-meiotic expression of the Arabidopsis pirl1;pirl9 mutant pollen phenotype.2011 · DOI: 10.1007/s00425-010-1324-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0476700`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017892 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009555 pollen development Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0000814 ESCRT II complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G11330

ath:AT4G27040

ath:AT5G05850

dosa:Os04g0476700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.570

Rank 1 · LXL04_017892 · OH-1004

Cytoplasm0.379

Rank 2 · LXL04_017892 · OH-1004

Mitochondrion0.057

Rank 3 · LXL04_017892 · OH-1004

Cell membrane0.042

Rank 4 · LXL04_017892 · OH-1004

Endoplasmic reticulum0.024

Rank 5 · LXL04_017892 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5M759`	Arabidopsis thaliana	Vacuolar protein sorting-associated protein 22 homolog 1	49.219%	Swiss-Prot	moderate database homology
`Q9FFJ3`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 1	48.000%	Swiss-Prot	moderate database homology
`Q8VYG9`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 9	40.741%	Swiss-Prot	moderate database homology
`Q7XK44`	Oryza sativa subsp. japonica	Plant intracellular Ras-group-related LRR protein 3	31.959%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card